KEGG   Anoxybacillus flavithermus: Aflv_2530Help
Entry
Aflv_2530         CDS       T00790                                 

Gene name
hisI
Definition
(GenBank) Phosphoribosyl-AMP cyclohydrolase/pyrophosphohydrolase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
afl  Anoxybacillus flavithermus
Pathway
afl00340  Histidine metabolism
afl01100  Metabolic pathways
afl01110  Biosynthesis of secondary metabolites
afl01230  Biosynthesis of amino acids
Module
afl_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:afl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Aflv_2530 (hisI)
Enzymes [BR:afl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     Aflv_2530 (hisI)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     Aflv_2530 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG DUF3239
Motif
Other DBs
NCBI-ProteinID: ACJ34885
UniProt: B7GL44
LinkDB All DBs
Position
complement(2506711..2507334)
Genome map
AA seq 207 aa AA seqDB search
MNVKEVRFNEQGLVPAIVQDAHSKEVLTLAYMNEQSLQKTLETKETWFYSRSRQELWHKG
ETSGNVQNVVDIRYDCDADALLVLVEPKGPACHTGEYSCFHRRLSDEKPVAKPDRFAILN
VLESIIAEREAKRPEGSYTTYLFDKGIDKIAKKVGEEAAEVIIAAKNRSKEELRWEAADL
LYHLLVLLREQRVSLDEVLSVLAERHR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaaaagaggttcgatttaatgaacaagggcttgtgccggcgatcgtacaagat
gcgcatagtaaagaagtgttgacgttagcttatatgaacgagcaatcgctgcaaaagacg
ttagaaacgaaagaaacatggttttatagtcgttcgcgacaggagctatggcataaagga
gaaacgtccggaaacgtacaaaacgttgtagatattcgttatgattgtgatgcagatgcc
cttcttgttcttgttgagcccaaggggcctgcatgtcatacgggagagtattcttgtttt
catcgccgtttaagtgatgaaaaaccagttgccaagccggatcgttttgcaattttaaac
gtgctagagtcgatcatagcagaacgtgaagccaaacggccagaaggatcgtatacaaca
tatttatttgataaaggaatcgataaaatcgccaaaaaagttggggaagaagccgcagaa
gtcatcattgccgcaaaaaaccgttcaaaagaagaattgcgttgggaagcggccgattta
ttgtatcatttgcttgtcttgttgcgcgaacaacgcgtgtcgcttgatgaggtgctttct
gtattagcggagcgtcatcgataa

DBGET integrated database retrieval system