KEGG   Anoxybacillus flavithermus: Aflv_2723Help
Entry
Aflv_2723         CDS       T00790                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
afl  Anoxybacillus flavithermus
Pathway
afl00240  Pyrimidine metabolism
afl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Aflv_2723 (tdk)
Enzymes [BR:afl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Aflv_2723 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK IMPDH AAA_14 AAA_19
Motif
Other DBs
NCBI-ProteinID: ACJ35076
UniProt: B7GMH4
LinkDB All DBs
Position
complement(2709653..2710273)
Genome map
AA seq 206 aa AA seqDB search
MYVMKQSGWLEVICGSMFSGKSEELIRRVRRAQFAKQEVKVFKPAIDNRYSEEAVVSHNG
TSVIAIPVSCASDIRKHITTHTDVVAIDEVQFFDEHVVDVVQQLADEGYRVIVAGLDQDF
RGEPFGPVPTLMSIAESVTKLQAVCTVCGSPASRTQRLINGRPASYYDPVILIGASESYE
PRCRHHHEVPDHPAKKKTSTETATRP
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtatgttatgaagcaatccggctggctcgaagtcatttgcggcagtatgttttcagga
aaatcagaggagcttattcgccgcgtacgtcgcgcacagtttgcaaaacaagaagtgaaa
gtgtttaagccagccatcgacaaccgatatagcgaagaagctgtcgtttcacataatggt
acatctgtcatcgccattccggtatcgtgtgcgtcggacatccgaaagcatattacaacg
catacagatgtggtcgcaattgatgaagtgcaattttttgacgagcatgtcgttgacgtt
gttcagcagctcgcagacgaaggatatcgcgtcattgtcgctggtttagatcaagatttt
cgtggggaaccttttgggcctgtcccaacgttaatgtctatcgctgaatcggtgacgaag
ttgcaagctgtttgtaccgtctgcggctctcctgcttcgcgcacgcagcggctcattaac
ggtcgtccggcgtcttattacgatcccgtcattttaattggagcgagcgaatcgtacgag
ccacgttgtcgtcatcatcatgaagtgcctgatcatccagcgaaaaagaaaacaagtaca
gaaacggcgactcgtccataa

DBGET integrated database retrieval system