KEGG   Anoxybacillus flavithermus: Aflv_2772Help
Entry
Aflv_2772         CDS       T00790                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase large subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
afl  Anoxybacillus flavithermus
Brite
KEGG Orthology (KO) [BR:afl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Aflv_2772 (ahpF)
Enzymes [BR:afl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Aflv_2772 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO NAD_binding_7 AlaDh_PNT_C FAD_binding_3 Thi4 Glutaredoxin K_oxygenase NAD_binding_8 FMO-like Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: ACJ35125
UniProt: B7GMM3
LinkDB All DBs
Position
complement(2757781..2759310)
Genome map
AA seq 509 aa AA seqDB search
MILDAEIKTQLAQYLQLMENDIVLKVSAGDDKVSRDMLALVDELATMSPKIKVEKTTLER
TPSFSVNRVGEDTGVVFAGVPLGHEFTSLVLALLQVSGRPPKVDQAVMEQIKHLKGTYRF
ETYVSLTCHNCPDVVQALNVMSVLNPNVSHTMIDGAAFKEEVEQKDVMAVPTVFLNGEPF
ASGRMSLEEILAKLGSTPDASTFAEKDPFDVLVIGGGPAGATAAIYAARKGIRTGIVAER
FGGQILDTLGIENFISVKYTEGPKLAASLEEHVKHYNVDIMNLQRAKRLEKKDLIEVELE
NGAVLKSKAVIIATGARWRNLGVPGEAEFKNKGVAYCPHCDGPLFEGKHVAVIGGGNSGV
EAAIDLAGIAKHVTVLEFAPELKADAVLQDRLYSLPNVTVIKNARTKEITGTDKVNGLTY
IDRATGEEHHIELQGVFVQIGLVPNTEWLEGTVERNRFGEIIVDKRGATNVPGVFAAGDC
TDSAYKQIIISMGSGATASLGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgatattggatgcggaaattaaaacacagctcgcccaatatctacaattgatggaaaat
gacattgtattaaaagtgagcgcgggagacgataaagtttcccgcgatatgcttgcttta
gtcgacgagcttgctacaatgtcaccgaaaatcaaagtagagaaaacaacgctagaaaga
acgccaagttttagtgtcaatcgcgttggtgaagatacaggcgttgtattcgcgggcgtg
cctttaggacatgaatttacttctctcgtgcttgcgttgcttcaagtgagtggaagacca
ccaaaagtcgatcaagcggtcatggaacaaattaaacatttaaaagggacgtatcgtttt
gaaacatacgtcagcttgacatgccataattgcccagatgtcgtacaagcgttaaacgtc
atgagcgtattgaatccgaacgtttcacatacgatgattgatggagcagcgtttaaagaa
gaagtcgaacaaaaagacgtcatggctgtgccgacggtctttttaaacggtgaaccgttc
gcaagcggacgcatgtcgcttgaggaaattcttgcgaagttaggaagcacgccggatgct
tctacttttgcggaaaaagacccatttgatgtgcttgtcatcggtggcggacctgccggt
gcaacagcggcgatttatgcagcgcgtaaaggcattcgtacaggaatcgttgcggagcgc
ttcggcggtcaaattttagacacgttaggtattgaaaactttattagcgtcaaatacaca
gaaggtccgaagcttgcggcaagtcttgaggaacatgtgaaacattataacgttgatatt
atgaatttacagcgtgccaaacggttagaaaagaaagacctgattgaagtagagcttgaa
aacggtgcggtgttaaaaagtaaagccgttattattgccacaggtgcacgttggcgtaat
cttggtgtcccaggtgaagcggagtttaaaaataaaggggtcgcttactgcccacattgt
gacggaccgttatttgaaggaaaacatgtcgccgtcatcggcggtgggaactctggagta
gaagcagcgattgaccttgctggaattgctaagcatgtaacagtgcttgaatttgcgcca
gaattaaaagcggacgctgtattgcaagatcgtttatacagcttaccgaacgtcacagta
atcaaaaacgcgcgaacgaaagaaattacaggaacagataaagtgaacggtctcacatat
attgatcgcgcaacaggcgaagagcaccatattgaacttcaaggtgtattcgtgcaaatc
gggcttgtaccgaatacagaatggttagaaggaacggtagagcgcaatcgctttggggaa
attattgtcgataaacgcggtgcgacaaacgttcctggcgtcttcgctgctggcgattgt
acagatagcgcatataaacagattatcatttctatgggctccggcgcaacggcttcttta
ggagcgtttgactacttaattcgaaattaa

DBGET integrated database retrieval system