KEGG   Aspergillus fumigatus: AFUA_1G12170Help
Entry
AFUA_1G12170      CDS       T01017                                 

Definition
(RefSeq) translation elongation factor EF-Tu
  KO
K02358  elongation factor Tu
Organism
afm  Aspergillus fumigatus
Brite
Translation factors [BR:afm03012]
 Eukaryotic Type
  Elongation factors
   AFUA_1G12170
 Prokaryotic Type
   AFUA_1G12170
Mitochondrial biogenesis [BR:afm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AFUA_1G12170
Exosome [BR:afm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AFUA_1G12170
  Exosomal proteins of breast cancer cells
   AFUA_1G12170
  Exosomal proteins of colorectal cancer cells
   AFUA_1G12170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 3510635
NCBI-ProteinID: XP_752585
UniProt: E9RD31
LinkDB All DBs
Position
1
AA seq 440 aa AA seqDB search
MSSISRTANLLLRSSKASLLRPRALNPVQHVFGNNKLAARGLATTFERTKPHVNIGTIGH
VDHGKTTLTAAITKHQSEKGLANFLEYGAIDKAPEERKRGITISTAHIEFSTDSRHYAHV
DCPGHADYIKNMITGAANMDGAIVVVAASDGQMPQTREHLLLARQVGVQKIVVFVNKIDA
IDDPEMLELVELEMRELLNSYGFEGEETPIIFGSALCALEGRRDDIGKDRIEQLMNAVDT
WIPTPQRDLDKPFLMSVEEVFSIAGRGTVASGRVERGILKKDSEVEIVGGSFEPKKTKVT
DIETFKKSCDESRAGDNSGLLLRGIRREDVKRGMVIAVPGSTKAHDKFLVSMYVLTEAEG
GRRTGFGANYRPQVFIRTADEAADLSFPDGDQSRRVMPGDNVEMILKTHHPVAAEAGQRF
NIREGGRTVATGLITRVMTE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcatctccagaaccgcaaaccttcttctgcgctccagcaaggcttctttgctg
cgtcctcgcgccctcaaccctgtccaacatgtgtttggcaacaacaaactagctgctcgt
gggctggctactaccttcgagcgtactaagcctcatgttaacattggtaccattggacac
gtcgatcacggcaagaccaccttgaccgccgctatcaccaaacatcagtcggagaagggc
cttgccaacttccttgaatacggtgccattgacaaggctcctgaggagcgcaagcgaggt
atcaccatctccactgctcacatcgagttctcgacggactcccgacactacgcccacgtc
gactgccccggtcacgccgattacatcaagaacatgattactggtgctgctaacatggac
ggcgctattgtcgttgttgctgcctccgacggtcagatgccccagactcgtgagcatttg
ctgctcgcccgccaggttggtgtccagaagatcgttgtcttcgtcaacaaaatcgatgct
attgatgatccggagatgctggaactggtcgaactcgagatgcgtgagctgctgaacagc
tacggtttcgagggtgaagagactccgatcattttcggttccgctctctgtgctctcgaa
ggacgccgtgacgacatcggtaaagacagaattgagcagcttatgaacgctgtcgacacc
tggatccccactcctcagcgtgacctcgacaaacctttcttgatgtctgtcgaggaagtg
ttctctatcgccggccgtggtaccgtggcttctggtcgtgtcgagcgtggtatcttgaag
aaggactctgaggttgagattgttggaggctccttcgaacccaagaagaccaaagtcacc
gacattgaaaccttcaagaagagctgtgatgaatcgcgtgctggtgacaactctggtctc
ctcctgcgtggtatccgacgtgaagacgtcaagcgtggtatggtcattgctgttcccggc
agcaccaaggctcacgacaagttcctcgtctccatgtacgtcctgaccgaggcggagggt
ggtcgtcgtactggcttcggtgccaactaccgtccccaagtcttcatccgtactgcagac
gaggctgctgacctcagcttccctgacggcgaccaatctcgcagagttatgcctggtgac
aacgtcgagatgatcctgaagacccaccaccctgttgctgctgaggctggtcaacgcttc
aacattcgtgagggtggccggactgtcgctactggtctgatcacacgagtcatgaccgag
taa

DBGET integrated database retrieval system