KEGG   Aspergillus fumigatus: AFUA_1G16250Help
Entry
AFUA_1G16250      CDS       T01017                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
afm  Aspergillus fumigatus
Pathway
afm00052  Galactose metabolism
afm00500  Starch and sucrose metabolism
afm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AFUA_1G16250
   00500 Starch and sucrose metabolism
    AFUA_1G16250
Enzymes [BR:afm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     AFUA_1G16250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Fibrillin_U_N
Motif
Other DBs
NCBI-GeneID: 3510016
NCBI-ProteinID: XP_752991
UniProt: Q4WRH9
LinkDB All DBs
Position
1
AA seq 881 aa AA seqDB search
MLRSLLLLAPLVGAAVIGARDHSQECPGYKATNIREGRDSLTADLTLAGKPCNTYGTDLK
NLKLLVEYQTDKRLHVKIYDADEEVYQVPESVLPRVDGKGGSSKKSALKFDYQANPFSFK
VKRGGEVLFDTSGSNLIFQSQYLSLRTWLPEDPNLYGLGEHTDSLRLETTNYTRTLWNRD
AYAIPEKTNLYGTHPVYYDHRGQHGTHGVFLLNSNGMDIKIDKTKDGKQYLEYNTLGGVF
DFYFFTGATPKDASIEYAKVVGLPAMQSYWTFGFHQCRYGYRDVFEVAEVVYNYSQAKIP
LETMWTDIDYMDRRRVFTLDPERFPLEKMRELVSYLHNHNQHYIVMVDPAVSVSDNVGYN
DGMEQGIFLQTQNGSLYKGAVWPGVTAYPDWFHPDIQKYWNDQFAKFFDPKTGVDIDGLW
IDMNEAANFCPYPCSDPEGYARDNDLPPAAPPVRPSNPRPLPGFPGDFQPSSSSKRSTKG
SKVGLPNRDLINPPYMIRNEAGSLSNKTINTDIIHAGEGYAEYDTHNLYGTMMSSASRNA
MQHRRPGVRPLVITRSTYAGAGAHVGHWLGDNISEWSKYRISISQMLAFASMFQVPMIGS
DVCGFGGNTTEELCARWARLGAFYTFFRNHNEITGIPQEFYRWPTVAESARKAIDIRYRL
LDYIYTAFHRQTQTGEPFLQPMFYLYPKDKNTFSNQLQFFYGDAILVSPVTDGSQTSVDA
YFPDDIFYDWHTGAALRGRGANVTLSNIDVTEIPIHIRGGSIIPVRSESAMTTTELRKKG
FELIIAPGLDGTASGSLYLDDGDSIEPRATLELEFTYRKGHLQVKGKFGFRTEVKINAVT
LLGQSAPASKSADVASLDSGRQAVTIKTSLDLTGPSEIDLS
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgttgagatcgctgctacttcttgcgccccttgtgggcgctgccgtgatcggcgccagg
gaccacagccaggagtgtcctggttacaaggccaccaatattagagagggtcgcgattcc
ttaacggcggatttgaccttggccggtaaaccgtgcaacacttacggcaccgacttgaag
aatctgaaactccttgttgagtaccagaccgataaacgcctccatgttaagatctatgac
gccgatgaggaggtttaccaagtccccgagtcggttctccctcgcgtggatggcaaaggt
ggatcgagcaagaagtcggcgctcaagttcgactatcaggcgaatccgttctctttcaag
gtcaagagaggcggcgaggtgctcttcgacacctccggttcgaatctgatcttccagtcg
cagtacctgagcctccgcacctggttgcccgaggatcctaatctctacggtcttggcgag
cacactgattctcttcgtctggagaccaccaactacacgcgtactctgtggaaccgtgac
gcgtatgctattcctgagaagaccaacctgtacggcactcatcccgtgtactatgaccac
cgtggccaacacggcacccacggtgtcttcttgctgaactccaacggcatggacattaag
atcgacaagaccaaggatggcaagcagtacttagagtacaacactctgggaggtgtcttt
gacttttacttctttaccggtgccacccccaaggatgccagcatcgagtatgcgaaagtc
gtcggtcttcccgctatgcagtcctactggacgttcggtttccaccaatgcagatacggc
tatcgtgatgtctttgaggtcgccgaggttgtctacaactacagccaggcgaagattcca
ctggagaccatgtggaccgacattgactacatggacagacgtcgggtgttcactcttgac
ccggagcgattcccgctcgagaagatgcgtgagttggtgtcatatcttcacaaccacaac
caacactacatcgtcatggttgacccggccgtcagcgtgagcgacaacgttggctacaat
gatggcatggagcagggcatcttcctgcagactcaaaacggtagcctctacaagggtgcc
gtctggcctggtgtgactgcgtatcctgactggttccaccctgacatccaaaagtactgg
aacgaccagtttgccaaattcttcgaccccaagaccggcgtcgacatcgacggtctgtgg
atcgatatgaacgaggccgccaacttctgcccttacccttgcagtgatcccgagggctac
gctagggataacgacctgcctcccgccgctccccccgttcggcccagcaacccgcgcccg
ttgcccggattccctggtgatttccagccctcatcctcgtcgaagcgctccaccaaggga
tctaaagttggactgcctaatcgtgacctgatcaaccctccgtacatgatccgtaatgaa
gctggctcgctcagcaacaagaccatcaacaccgatatcattcatgctggtgagggatat
gccgagtatgacactcacaacctttatggtaccatgatgagttccgcttctcgcaatgcc
atgcaacaccgccgccctggggtgcggccattggtcatcactcgcagcacgtatgctggt
gctggcgcccacgttggacactggctcggtgacaacatctccgagtggagcaagtaccgc
atctccatctcgcagatgcttgcgtttgcctcgatgttccaggtgcctatgatcggatca
gacgtctgcgggttcggcggcaacaccaccgaggagctctgcgctcgctgggcgcgtctc
ggagccttctacaccttcttccgcaaccacaatgaaatcaccggtatcccgcaggagttc
taccgctggcccaccgttgccgagtccgctcgcaaggccatcgacatccgctacaggctg
cttgactacatctacacagccttccaccggcagacccagaccggcgagcccttcctgcag
cccatgttctacctctatcccaaggacaagaacaccttcagcaaccagctgcagttcttc
tacggtgacgccatcctggtcagccctgtcaccgacgggagccagacttcagttgacgca
tacttccccgatgatatcttctacgattggcacacgggcgccgccctacgcggccgcgga
gccaacgtcaccctcagcaacatcgacgtgactgagatccccatccacatccgcggcggc
agcatcatccccgtccggtccgagtccgccatgaccaccaccgagctgcgcaagaagggc
ttcgagctcatcatcgccccagggcttgatgggactgcctcgggcagtttgtatctcgac
gacggcgactccatcgagccgcgcgcgaccctcgagctggagttcacgtaccgcaagggc
catctccaggtgaagggcaagttcggtttccgcacggaggtcaagatcaacgccgtcacc
ctgcttggccagtctgcgcctgcctccaagtctgcagacgtggcctcccttgactctggc
cgccaggcagtgaccatcaagacgagcctggatctgactggtccttccgagattgacctc
agctag

DBGET integrated database retrieval system