KEGG   Aspergillus fumigatus: AFUA_2G11610Help
Entry
AFUA_2G11610      CDS       T01017                                 

Definition
(RefSeq) alpha-glucosidase/alpha-amylase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
afm  Aspergillus fumigatus
Pathway
afm00052  Galactose metabolism
afm00500  Starch and sucrose metabolism
afm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AFUA_2G11610
   00500 Starch and sucrose metabolism
    AFUA_2G11610
Enzymes [BR:afm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     AFUA_2G11610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase Malt_amylase_C
Motif
Other DBs
NCBI-GeneID: 3512891
NCBI-ProteinID: XP_755493
UniProt: Q4X110
LinkDB All DBs
Position
2
AA seq 602 aa AA seqDB search
MPDPTTRNKSVTASGTFKPQILDMDREWWREIIIYEIYVQSFQDSNNDGIGDLRGIVQRL
DYLKDLGADMLWLTPIYESPLEDQGYDIANYKGINPIYGTMKDWEDLAAEIHRRGMKIMM
DMVFNHTSSQHAWFLESKKSRDNPKRDWYFWRRGKIGTNGERLPPNNWESLFGGPAWKYD
EHTDEWYMHLFSPSQPDLNWDNPEVRNAVFDVIDFWGQKGTDGFRFDVINLVSKTPGLPD
APIVNPDKYEQPAVPLFTNGPNIHTYMHEMNRKVLSKYTNCTVGEMPCGVDEYESSQYVA
KERQELSMVFQFHHMDLDGENGDKWKPRKWELWEFEKVFRIWQQHMLGNNGWNSLYLENH
DQSRCVSRFGNPDPRYRAVSAKMLATIQLSLRGTPFIYQGQELGTPHPQNWKIEDYNDVE
THGYYNAQYKARKEKDPSKEPDMSDVMDVIRLKGRDNARSPIMWNNAPNAGFTSPDAKPW
LRMNDEYANINVQAQTRDPDSVLNYYKKLLHIRKQHPLMWYGVYIPINASDPKVFSFLRT
QGPWRTLIFCNWAAEESDFEIPEEIDIDLAVMLIANYHVDEYQLQQKVRLRPYEARIYSL
RN
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgccagatccaacgactcggaacaagtccgtgacggcgtccggcacgttcaagccgcaa
attctcgatatggatcgagaatggtggcgagagatcatcatctatgagatctacgtgcag
tcgtttcaggatagcaacaatgatggtattggtgatcttcgcggcatcgtccagcggctc
gactatctgaaagaccttggggcggatatgctgtggttgacaccaatctatgaatcaccc
ctcgaagatcaaggctacgacattgcaaattacaagggtatcaatccaatatatgggacc
atgaaagactgggaagaccttgctgcagaaattcataggagaggaatgaagataatgatg
gacatggtgttcaaccacaccagctctcagcatgcatggttcttagagtcaaagaaaagc
cgagacaacccgaagagagactggtacttctggagaaggggaaagataggcacaaatgga
gagcgcttacctcctaacaattgggaaagtctttttggaggtccggcatggaagtatgat
gagcatacagacgaatggtatatgcatctgttctcgccatctcagccagacctgaactgg
gacaatcctgaggtgcggaatgcagttttcgacgttattgatttctggggacaaaaagga
acagacggcttccggtttgatgttataaaccttgtctccaagacacctggtcttccggat
gcacccattgtgaaccccgataagtacgagcaacctgccgtgccattattcacgaacggt
cccaatatccacacatatatgcatgagatgaatcgcaaggtgctgagcaaatacaccaat
tgcacagttggtgaaatgccgtgtggtgtggacgaatacgagtccagtcagtatgtggcc
aaggagcgtcaggagctctctatggtcttccagtttcaccatatggatctggatggtgaa
aatggagacaaatggaagcctcgcaagtgggaactctgggaatttgagaaagtgttcagg
atttggcagcagcatatgctgggcaacaacggatggaattctctgtatcttgaaaatcat
gaccaatcccggtgtgtgtcacgatttggcaaccctgatccgcgatacagagccgtgtca
gccaagatgttggctacaattcagctctctctaagaggaaccccttttatctatcagggc
caggaattgggcaccccacatccccagaactggaagattgaagattataacgatgttgag
acgcatggatactacaacgctcagtacaaagctcgcaaagaaaaagatccctccaaggag
cctgacatgtccgatgtgatggatgtcattcgcctcaaaggacgggacaatgcgcgtagc
cctatcatgtggaataatgcgcccaatgcagggttcacttccccagatgccaaaccttgg
ctccgaatgaacgatgaatatgccaatatcaacgtccaggctcagactcgtgatcccgac
tcggtcctgaactactacaagaagctgttgcatatccgcaaacagcatccgctgatgtgg
tacggagtctatattcctatcaatgcgagtgaccccaaggtcttctctttcctgcggact
caagggccgtggcgcaccttgatcttctgcaactgggcggcggaagagtccgatttcgaa
attcccgaagagattgacattgacttggctgtcatgctcatcgccaactaccatgtggat
gaatatcagctgcagcagaaggtccgactcaggccatatgaggcccgtatctactccctt
cgtaactga

DBGET integrated database retrieval system