KEGG   Aspergillus fumigatus: AFUA_2G15930
Entry
AFUA_2G15930      CDS       T01017                                 

Definition
(RefSeq) alcohol dehydrogenase, zinc-containing
Organism
afm  Aspergillus fumigatus
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C FAD_binding_3 2-Hacid_dh_C Pyr_redox ADH_N_assoc PALP Shikimate_DH NAD_binding_7 Pyr_redox_2 ADH_zinc_N_2 Pyr_redox_3
Other DBs
NCBI-GeneID: 3513236
NCBI-ProteinID: XP_755928
UniProt: Q4WZS5
LinkDB
Position
2
AA seq 353 aa
MRAVRFYGRGDIRVDEIDEPVCGEGQVKIRPAFVGICGSDLHEYLAGPITVPSTPHPITG
GSVPVTLGHEFSGVVEEVGAGVSRLKVGDRVAVKPNLYDGTCANCLAGWRNCCQNLGFIG
YSSDAGGLSDHVVVGEKHAILLPEGFPLDLGALVEPLTVAWHAVSRASVRPDDTVLVVGG
GPIGLAVIQVLKARGVKSIIVSEVSSQRKKFARQLGATEVFDPRTDDIVASVRAMTAGGG
AAIAFECSGVQVGLDTAVQAIGARGTVTIVSLWEEKPKIDALDMVLHEKHIIGAVICDDG
DFEAVIDAISSGKLCPRAMITSKILMEDVVAKGFKALVDERGKHVKILVEVST
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgagagctgtcaggttctatggccgcggcgatatccgtgttgacgagattgatgagcct
gtctgcggcgaggggcaagtcaagatccgacctgcctttgtagggatctgcggaagcgac
ctacatgagtaccttgcaggtcccatcacagttccctcaacaccgcatccaatcacgggc
gggagcgtccccgtcaccctgggccatgagttcagtggtgtggtagaggaggtcggcgcg
ggtgtctcacgactgaaagtcggtgatcgcgtggctgtcaagccgaatctgtatgatggg
acgtgtgcgaattgtctagctggttggcgtaactgttgtcagaacttgggatttattggg
tatagcagcgatgcaggaggtttgtcagatcatgttgttgtaggtgagaagcatgcgatt
ctgttgccggagggattccctctggatcttggggcccttgtcgaaccccttactgtggcc
tggcatgcagttagccgtgcctccgtccggcccgacgacactgtcctcgtggtgggggga
ggacccatcggtctcgctgtcattcaggtcctgaaagcccgcggagtcaagtccatcata
gtctccgaagtatcctcacagcgtaagaagtttgcgagacaactaggtgcgactgaggtc
tttgatccgcggacggatgatattgtggcttcagtccgcgcaatgacggcaggaggaggg
gcagccatcgcatttgaatgctccggcgtgcaagtgggcttggacacagctgtgcaggct
attggagccaggggaacggtaaccatagtatcgctgtgggaggagaagccgaagatcgat
gcgctcgatatggttttacacgagaaacatatcattggcgctgtgatttgtgacgatggc
gattttgaagctgtcattgatgcgatttcatcaggaaagctctgccctcgagcgatgatc
acaagcaagatcctgatggaggacgtggtggccaagggattcaaggctttagttgacgag
cggggcaagcatgtcaagatcctagttgaggtgtctacatga

DBGET integrated database retrieval system