KEGG   Aspergillus fumigatus: AFUA_3G00610Help
Entry
AFUA_3G00610      CDS       T01017                                 

Definition
(RefSeq) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
afm  Aspergillus fumigatus
Pathway
afm00500  Starch and sucrose metabolism
afm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AFUA_3G00610
Enzymes [BR:afm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AFUA_3G00610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 3505797
NCBI-ProteinID: XP_748381
UniProt: Q4WFY4
LinkDB All DBs
Position
3
AA seq 619 aa AA seqDB search
MRFAGIACIASVLGHLATPSSAKELAARSPAAANSRLVKEGLFAYESILAALGNTGINAP
GTAAGLLIASPTIQNPDYFYTWTRDAALTFKGLVDIFIGGDTFIVVNLDGLETHIQDYIS
SQAVLQNVSNPSGRLSDGSGLGEPKFEVNFNPYSGGWGRPQRDGPALRAITMLTYIRQLI
QQGKQSVASNLIWPVVANDLTYVAQYWNHTGFDLWEEIDGSSFFTTAVQHRAMVEGSAIA
QALGKPHAGYDAVAPEILCLLQSYWNESAIISNINVNNGRSGIDLNSVLTSIHTFDPAAG
CDDSTFQPCSSKALANHKVYVDSFRSIYGINAGLGPGKAANVGRYAEDVYQGGNPWYLAT
LAAAEQLYDALYQWKKQGYLTVTQTSLAFFRDFSSTVEPGTYKSNTPTYKSLTDYVRTYA
DDFFFLVEKYTPSNGSLAEQYDRNTGVPLSANDLTWSYAAFLSTLQRRLNIMPDSWGPSS
ANPVPTTCSKTTITGTYSAVAPPFPTSTAQCVAAVTVPVTFWLIENTYYGENVYMTGNVS
ALGDWNASAGYSLNAGLYTSDENLWFATVKGLEPGVTMEYKFYKIEPGNSVTFEGGENRV
YAVPTACPVAPQVHAVWQT
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgcgatttgctggcattgcttgcatagccagtgtcctagggcacttggccactccttcg
tctgctaaagaacttgctgcacgctcccctgcagcggcaaattcacgtctggtcaaagag
ggactgttcgcctacgagagcattcttgcggctcttgggaacactggcatcaatgctcct
ggcacagcggctggattactcattgcaagtcctaccatacagaaccctgattacttctat
acgtggactcgggatgcggcattgactttcaaaggacttgtcgatatcttcattgggggc
gatacatttatcgtcgtcaatctcgacggtcttgaaacccacatccaggactacatctct
tcccaggcagttttgcagaacgtgtccaacccatccggaagactttctgacggctctgga
ctcggcgagcccaagttcgaggtcaatttcaacccatactccggcggttggggccgtccc
cagcgcgatggtcctgcccttcgcgccattaccatgttgacctatattcgtcagctaatc
cagcaagggaaacagtctgtggcttccaacctgatctggcccgttgtagccaacgatctc
acctatgtcgcgcagtactggaaccacaccggattcgatctctgggaagaaatcgatggc
tcttccttctttacgactgccgtgcagcaccgagcgatggttgagggtagtgcgatagct
caagcccttggtaagccacatgctgggtatgacgcggttgctcccgagattctttgcttg
ctgcagagctactggaacgaaagcgccattatctcgaacatcaatgtcaataacggccgg
tcgggcatcgatctcaactcagtcctgaccagtattcatacctttgaccctgcggctggt
tgtgatgattccaccttccaaccatgttcgtctaaagctttggcaaatcataaggtctat
gtcgattctttccgttctatctacggtatcaacgctggccttggtcctggaaaggctgca
aatgtaggccgttacgctgaagatgtttaccagggaggaaatccatggtacctcgcaact
cttgcggcggcagagcagctgtatgatgccctctatcagtggaaaaagcagggttatctg
accgtcacacaaacctcgctcgccttcttccgtgacttctcgtccaccgtcgagccagga
acttacaagtcgaataccccgacctacaaatccctgactgattatgtccgcacctacgct
gatgacttcttcttccttgttgaaaaatacaccccaagcaacggctccttagccgagcag
tatgaccgcaacaccggtgtccctctgtcagccaacgatcttacctggtcctatgcagcc
ttcctctctacccttcagcgccgcctcaacatcatgcctgactcctggggcccctcgtct
gcaaatcctgttcccactacctgcagcaaaaccaccataactggtacatatagtgctgtg
gcgcctccctttccgacgtccaccgctcagtgcgttgccgctgtgactgttcctgtcacc
ttttggttgatcgagaatacctactatggcgagaatgtgtacatgaccggcaacgtcagc
gctctcggtgactggaacgccagcgcaggctatagtctgaatgccggtctctacacctcg
gatgagaatctttggttcgcaactgtcaagggactcgagccgggtgttaccatggagtac
aagttctacaagattgaaccgggaaactccgtgacttttgaggggggggagaacagggtg
tatgcagttcctacagcatgtcctgtggcgcctcaggtccacgcggtttggcagacctga

DBGET integrated database retrieval system