KEGG   Aspergillus fumigatus: AFUA_3G07810Help
Entry
AFUA_3G07810      CDS       T01017                                 

Definition
(RefSeq) succinate dehydrogenase subunit Sdh1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
afm  Aspergillus fumigatus
Pathway
afm00020  Citrate cycle (TCA cycle)
afm00190  Oxidative phosphorylation
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
afm01130  Biosynthesis of antibiotics
afm01200  Carbon metabolism
Module
afm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
afm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
afm_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AFUA_3G07810
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AFUA_3G07810
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AFUA_3G07810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 3512570
NCBI-ProteinID: XP_754832
UniProt: Q4WX09
LinkDB All DBs
Position
3
AA seq 647 aa AA seqDB search
MSSLSLRSLAPASKISRALRDQRRFFSSTRPAARIFANGPLRAKEATGYISSKYPVIDHE
YDAVVVGAGGAGLRAAFGLAEAGFNTACVSKLFPTRSHTVAAQGGINAALGNMHPDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPASVRELEGYGCPFSRTEDGLIYQRAFGGQSKEFG
KGGQAYRCCAVADRTGHALLHTLYGQSLRHNTNYFIEYFALDLLMEDGECRGIIAYNQED
GTLHRFKAHHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIY
GAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPEK
DHIYLQLSHLPPELLHERLPGISETASIFAGVDVTKQPIPVLPTVHYNMGGIPTKYTGEV
LTVDEQGNDKVVPGLYACGEAACVSVHGANRLGANSLLDLVVFGRAVSHRVRDIATPGKA
HRELSPDAGAQSIKDLDFVRNADGPKSTHEIRNAMQRAMQSDVSVFRTQESLDEGVQKIT
AIDKMFDQVGTKDRSMIWNSDLVETLELRNLLTCATQTAVAAANRKESRGAHAREDYPER
DDENWMKHTLTWQKKPHGEINLGYRAVEHRTLDENECKSVPPFKRVY
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgagctccctgagcttgcggagcctagctcccgcttcgaagatttcccgtgccttgagg
gaccagagacgttttttctcgtcgacaagaccagcagcccgcatattcgccaacggtcct
ttgcgcgctaaggaggctactggttacatttcctcgaagtatcctgttattgatcacgaa
tatgatgctgtcgttgtcggtgctggtggtgccggtctgcgtgccgccttcggtctggcg
gaagccggattcaacactgcctgtgtctcgaagctcttccctacaagatctcacactgtt
gccgctcagggtggtatcaacgctgctctgggaaacatgcatcccgacgactggagatgg
cacatgtacgacaccgtgaagggttccgattggcttggtgaccaggacgccatccactac
atgaccagagaggctcctgctagtgttcgtgagctcgagggctacggatgccccttctcc
cgtaccgaggatggccttatctaccagcgtgcgttcggtggtcagtccaaggaattcggc
aagggtggacaggcctaccgttgctgcgccgtcgctgatcgtaccggccacgctcttctg
cacactctctacggacagtctttgcgccacaacactaactacttcatcgagtacttcgct
cttgatctgctgatggaggatggtgagtgccgtggtatcatcgcctacaaccaggaggac
ggtaccctgcaccgcttcaaggcccaccacacagttttggccactggtggatacggacgt
gcctacttcagctgcacatctgcccacacttgcactggtgacggtatggccatggtcgcc
cgtgctggtttgcccaaccaagatcttgagttcgttcagttccacccaactggtatttat
ggtgctggttgcctgatcaccgagggtgctcgtggtgagggtggttatctgctcaactcc
gagggtgagcgtttcatggagcgttacgcccccaccgccaaggatctggcgtctcgcgac
gtcgtctcccgttccatgaccctcgagattcgcgagggccgtggtgttggtcctgagaag
gaccacatctacctgcagttgagccacctgccccctgagcttctgcacgagcgtctgccc
ggtatctcggagactgcatccatcttcgctggtgttgacgtcaccaagcagcccatcccc
gtcctgcccaccgtccactacaacatgggtggtatccccaccaagtacaccggtgaggtc
ttgacggtggatgagcagggtaacgacaaggttgtccccggtctgtacgcctgtggtgag
gccgcctgtgtctccgtccacggtgccaaccgtctgggtgccaactctctcctcgacctc
gtcgtcttcggccgtgccgtttctcaccgtgtccgtgacatcgccacccctggcaaggct
caccgtgagctgagccctgacgctggtgcccagtccatcaaggacctcgacttcgtccgc
aacgccgatggccccaagtcgactcacgagatccgtaacgccatgcagagggccatgcag
tctgatgtcagcgtcttccgtacccaggagagtttggatgagggtgttcagaagatcacc
gccatcgacaagatgttcgaccaagtcggtaccaaggaccgcagcatgatctggaactct
gaccttgtcgagactctggaactccgtaacctgctcacttgcgccactcaaaccgctgtc
gccgccgccaaccgcaaggagtcccgcggtgcccacgctcgtgaggactaccccgagcgt
gatgacgagaactggatgaagcatactctcacctggcagaagaagcctcacggtgagatc
aaccttggctaccgtgctgtcgagcacaggaccctcgacgagaacgagtgcaagagcgtg
cctcccttcaagcgtgtctactag

DBGET integrated database retrieval system