KEGG   Aspergillus fumigatus: AFUA_3G11140Help
Entry
AFUA_3G11140      CDS       T01017                                 

Definition
(RefSeq) DNA ligase I
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
afm  Aspergillus fumigatus
Pathway
afm03030  DNA replication
afm03410  Base excision repair
afm03420  Nucleotide excision repair
afm03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:afm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AFUA_3G11140
   03410 Base excision repair
    AFUA_3G11140
   03420 Nucleotide excision repair
    AFUA_3G11140
   03430 Mismatch repair
    AFUA_3G11140
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:afm03032]
    AFUA_3G11140
   03400 DNA repair and recombination proteins [BR:afm03400]
    AFUA_3G11140
Enzymes [BR:afm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AFUA_3G11140
    6.5.1.6  DNA ligase (ATP or NAD+)
     AFUA_3G11140
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     AFUA_3G11140
DNA replication proteins [BR:afm03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    AFUA_3G11140
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     AFUA_3G11140
DNA repair and recombination proteins [BR:afm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     AFUA_3G11140
   NER (nucleotide excision repair)
    Other NER factors
     AFUA_3G11140
   MMR (mismatch exicision repair)
    Other MMR factors
     AFUA_3G11140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C Spore_SspJ
Motif
Other DBs
NCBI-GeneID: 3512331
NCBI-ProteinID: XP_754505
UniProt: Q4WXY6
LinkDB All DBs
Position
3
AA seq 833 aa AA seqDB search
MPSPAKKRKREAPDSTPQRVRSIASFFQGQSNKKAEKTEQIVDSATESAADETLSDEALA
RKLQAEFDKEGAAPAVEPEVPNHKPIQEPYAPTESDSGPPKKVPKTNTISLQSSVGTEDT
ISLSIPFDQSPLTFDSTKCAAELQVHWATEGGNASYALLTRAFVLANATTSRIRIVDTLV
NFLRVLIEGDPSSVLPAVWLATNSISPPYDELELGLGGSAISKALKKVYGLNPYGLKSLY
DKYGDAGDVAFEAKKRQSFTLMKPKPLTIKGVYQSLRKIATSKGSGSQESKQRIVEKLLQ
DTRGAEESRYIVRTLVQNLRIGAVKTTMLIALARAFLYSKPEGAEFTIRSRQDLTRLKKE
ELAEIYSRAEEIVKASYARHPNYNDLVTCLLESGVTEELLLRCGLQLHVPLRPMLGSITR
DLSEMLTKLQGRDFSCEYKYDGQRAQVHCDEKGKVSIFSRHLENMTEKYPDLVSLVSQIR
GESVSSFILEGEVVAVDNKTGGLQTFQVLTNRAKKNVEIGAININVCLFAFDLMYLNGEP
LLDRPFRERRELLRSLFVEIPNRFTWVKSLDATSADSETVLEFFKSALENKCEGIMVKVL
DNAPKTSLEQNKEASTSNGMDVTSGEPLENAGKGGRRKALLSTYEPDKRLESWLKVKKDY
STSSETLDLIPIAGWHGQGRKAKWWSPILMAVRNPETGSLEAVTKCMSGFTDKFYQANKD
KYAEGTPNVISRPAYVEYYGEPDVWFEPQEVWEMAFADITLSPTYTAAIGLVSDERGLSL
RFPRFLRVRDDKSIDEATTSDYLALLWRKQAERKKEEEQHPSRDTEQLGWQEE
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcccggccaaaaagcgcaaaagagaggctccagattcaaccccacagcgtgtc
cggagcatagcgtcattcttccagggacaatccaacaagaaggccgagaagacggaacaa
attgttgactctgctaccgaaagtgcagcagacgaaacactatctgacgaagctcttgct
cgcaagcttcaagcggagttcgataaagagggtgctgcgccggccgtggagcctgaggtt
ccaaatcataagcctatccaggaaccttacgccccgacagagtcagatagtggaccgcct
aagaaagtcccgaaaaccaatacaatctcattgcagtcttccgttgggacagaagataca
ataagtctttccatccctttcgaccagagtccgttgacgttcgactcgacaaaatgcgcg
gcagagttgcaggtccactgggctacggagggtggaaacgcctcatatgctctgctgact
agagcgtttgtgttggcaaatgcaacgactagtcgaatcaggattgttgataccctggtc
aatttccttcgagttctgattgaaggcgatccttccagtgttttaccagcagtctggcta
gcgaccaactcgatttccccgccatacgacgaattggagcttggtttgggaggctccgcg
atatcgaaagcactgaagaaggtctacggactcaatccttatgggctcaaaagtctctac
gacaagtatggagacgctggcgacgtggctttcgaggcaaagaaaaggcagagcttcacc
ttaatgaagcccaagcctctgacgatcaaaggtgtctatcaatccttaaggaagattgcg
acgagcaaagggagtggtagtcaggagtccaagcagagaatcgtggagaaacttctacaa
gacactcgaggtgcggaagagagccggtacattgtacgcacgctggtgcaaaatttaaga
atcggggccgttaaaacaacaatgctcatcgcgctggctcgagcctttctatattcaaag
cctgaaggcgcagagtttacgatacgttcacgacaagatctgacgcgactaaagaaggag
gaactggccgaaatctacagccgggcggaagaaatcgtgaaggcatcatatgctaggcat
ccaaactacaacgacttagttacatgcttacttgaaagtggagttaccgaagaacttctt
ctgcggtgcggcctgcagcttcatgtacctctgagacccatgttgggcagtatcacgaga
gatctctctgaaatgctaacaaagctgcaaggacgggatttcagttgcgagtacaaatat
gatgggcagcgtgcacaggtgcactgtgacgagaaggggaaagtatcgatattttctcgc
catttggagaatatgacggagaagtacccagaccttgtgtccttggtctcgcaaatcaga
ggagagagcgtctctagcttcatattggaaggagaagttgtcgcagtagataacaaaacg
ggtggactccagacgttccaagttctgacaaatcgagcaaagaagaacgtggagatagga
gcaatcaacattaacgtttgcctcttcgcgttcgacttgatgtatctaaacggcgagcca
ctattggatcggccattccgcgagcgcagagagttgttacgcagcctatttgtggagatc
ccaaacagattcacttgggtcaaaagcctcgacgccacgtccgcagactcggagacggtc
ttggagttcttcaaaagcgccctcgagaacaaatgcgaagggatcatggtcaaggtgctt
gacaatgcacccaagacgagccttgaacagaataaggaggcctccacgagcaatggcatg
gatgtgacgagtggggaaccgctcgaaaatgcgggcaaaggcggcagacgaaaagcactt
ttatcaacatatgaaccagacaagcggctcgagtcgtggctcaaagtcaagaaggattac
agtacctcgtccgagaccctagatctgatccccattgctggctggcacggacaaggccga
aaagccaaatggtggtcccccattctgatggccgtccgcaaccctgaaacgggaagcctc
gaagcagtcactaaatgcatgtccggcttcacggacaaattctaccaagcgaacaaggac
aagtacgccgagggaacgcccaatgtcatctcacggccggcctatgtcgagtactacggc
gaacctgacgtctggttcgaaccgcaggaggtctgggagatggcattcgccgacatcacc
ttgagtccgacgtacacagctgccatcggcttagtgagcgacgagcggggactgagcctc
cggtttcctcggtttctcagagtaagagacgacaaatcaatagatgaagccaccacatcg
gactatctggctctcctgtggcggaagcaggccgaacggaagaaagaggaggagcagcac
cccagcagggacacagaacaactaggttggcaggaagagtag

DBGET integrated database retrieval system