KEGG   Aspergillus fumigatus: AFUA_4G04290Help
Entry
AFUA_4G04290      CDS       T01017                                 

Definition
(RefSeq) histone deacetylase HosB
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
afm  Aspergillus fumigatus
Brite
KEGG Orthology (KO) [BR:afm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:afm03036]
    AFUA_4G04290
Enzymes [BR:afm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AFUA_4G04290
Chromosome and associated proteins [BR:afm03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     AFUA_4G04290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl RTP801_C
Motif
Other DBs
NCBI-GeneID: 3503998
NCBI-ProteinID: XP_746614
UniProt: Q4W9N7
LinkDB All DBs
Position
4
AA seq 1191 aa AA seqDB search
MDPSIRDEPPQATFTAPPPPPPAPSSNDLTNSLNHLTIASAAATPLPTSPSPSSLLSPLD
VPARSSADLAHPVPRRTASSNSLSDERDERRKSTSSLKKRSSTASLRSGHNSAGANSPRP
SLSRRSSSSNFATPPTSTANMPSKRPQEQAAPTAASVAADFFQREVDLHQSTDLHSKVVV
VVHDACYGHRFSRPRTSKTALSYIVERPERIQACVVGVSAAYVLMAGRHAGKRFAPHPEL
DLHQLPAPPFQIRKTSRTMPITSAAVTHVHGTKWMDELKTMCDAAESRLALNGKELVRPR
SSGKDGDSAKKAPLNDGDLYLCSESLNAFEGALGGVCEGVDAVFNSNTTKRAFVCIRPPG
HHCSTSHPSGFCWINNVHVGITYAAMTHGLTHAAILDFDLHHGDGSQDIAWEQNQKAVSA
AWNAANHKKTRIGYFSLHDINSFPCEYGDVEKVRNASVCIDKAHGQSIWNVHLETWKSDA
EFWEIYAAKYTILLEKARAFLRLHTERLLDSAPGDTPPKAAIFISAGFDASEWEGSGMQR
HQVNVPTEFYAKFTADVVQMAEEEGLGVDGRVISVLEGGYSNRALTSGVLSHLAALGDTT
TLSAIVNHEQQVGLASEMFDRLHVSDSNAPAEALRTPSDIGYDSQWWAPTRLDELEALVY
PPPSTAPKSKSARTYFAPTQSFAAKVVAAPRDRKSTGSPAGSDVVPLPEVGWATAAHELS
KVLIPSHRQTTSYRPEELNAEASRIRRERQTAVAAAQASQKAASAASAASEGNRMQLRTR
KAKASLPSSPKAETPKKNVTKSTRRTTIDPGDLPSSTADSSPGVRTTRRKSTTPIASKPS
GAAESGRPNTSSLDVGASETPEQASIAAGSCPPESPSRSRSSTPSRSAAPKRSEGPKVPP
VPRVPSSFLSKPASSDDQKVVSDQAQAEMTEKTDSRPADLDDLAAGVKKLSIKLKVPTPE
EHAAREKQRKTTKAAKATEQHQRRAPRPTTSKTPTSSKKASSVTAAATAHASTARGTSHP
SPSPSTSQMPFGPNIAISNGNMDRVKQESPENAPDDLVVSSPDPLAENETPLLSNVTINR
PRWETPKDVLVSGSVSTQEAPSGSATPSSWASESLPGRSTVYSPPTTTRQTMNGLPVFTS
SCPIPFAAASTAPEGKQALAMQQPNLFTHSDNAGTGHPDLMHNQNYKPEQP
NT seq 3576 nt NT seq  +upstreamnt  +downstreamnt
atggacccctccatacgcgacgagcctccccaggcgacattcactgcaccaccaccacca
cctcccgcaccaagttccaacgatctaaccaatagtctgaatcatttgacaattgcttct
gcagccgcgactcctcttccaacctctccttccccgtcttcgttactgtcgcctctggat
gttcccgcgcgttcttctgctgatctggcgcatcctgtaccccgacgaactgccagttcc
aactctctaagtgatgaacgagatgaacgacggaaatccacctccagcctgaaaaagcga
tcatcgaccgcgtcgcttcgatctggacacaacagtgcaggcgcaaactcacctcgtccc
agtctatcgcgacgctcttcgtcctccaacttcgcgaccccccccacttccacagcaaat
atgccatccaaaagacctcaggagcaagctgcgcccactgcagcttctgtcgccgcggat
ttcttccaacgagaagtcgatttgcaccaatccaccgacctacattccaaagtcgtggta
gtcgttcatgacgcgtgctacggccatcgtttctcgcggccgcgaacgtcgaagaccgct
ttgagttacatcgtcgaacggcccgagagaatacaagcttgtgtggtgggagtatcggca
gcttatgtcctcatggccggccgccatgctggaaagcgctttgcccctcatcctgagctt
gatctacatcagctccccgcgccgccgttccaaatccgcaagacgtcgcggactatgcct
atcacgtctgcggctgtcactcatgtgcatgggactaagtggatggatgagctgaaaacc
atgtgtgatgcagcagaatcaagacttgctctgaatggcaaagagctggttcggccgcgc
agctcaggaaaggacggcgattccgccaagaaggctccgctgaacgatggtgacctttat
ctttgctcagaatctttgaatgcctttgagggcgcgctcggcggagtttgtgaaggtgtc
gatgccgtctttaactccaacactaccaaaagagcgtttgtctgtattcgaccccctggt
caccattgctctacctctcatccgtccggattttgctggatcaacaatgtacatgtgggt
ataacctacgctgccatgacccatggcctgacccatgccgctatactggatttcgacctg
catcatggcgacggttcgcaagatattgcgtgggaacagaatcagaaagccgtgtcagcg
gcctggaatgcagccaatcacaagaaaacgaggattggctacttcagcttgcatgacata
aactcttttccttgtgaatatggtgatgttgagaaggtgcggaacgctagtgtgtgtatt
gataaagcccacggtcagtcgatctggaatgtccacttggagacgtggaagtctgatgcg
gagttctgggaaatttatgccgccaagtacaccatactgttagagaaagcgcgcgctttt
ctacgtctgcacaccgaacgccttcttgatagcgcgcccggcgacactccgccaaaagcg
gcaattttcatatccgcaggattcgacgcgagtgagtgggaaggttctggtatgcagaga
caccaagtgaatgtaccgacagagttctatgcgaagttcaccgcggatgttgtgcagatg
gccgaggaagaagggctaggcgtagatgggcgtgtcatcagtgtcttggaagggggctat
agtaatcgagcattgaccagcggcgtcctcagtcatctcgcagcgctgggagacacaacg
acattgtcggccatcgtcaaccatgagcagcaggtcggtctggcttccgaaatgtttgac
cgcttgcatgtatcggacagcaacgctccagctgaagcactgcgcaccccatctgacatt
ggttatgatagtcagtggtgggcgccaacaagactcgacgagctggaggcgcttgtctat
ccacctccttccacagcgccaaaatcaaagtctgctcgcacctattttgcgcccacgcaa
tcttttgcagccaaagtcgttgcagcccctcgggatcgaaagtctactggctcaccggcg
ggctcagatgttgtacccttgccagaggtaggctgggctacggcggcacacgaactatcc
aaagtccttattcccagccatcgtcagaccacaagttatcgtccggaagaactaaatgcg
gaagcttcacgcattcggcgggaacgtcagaccgctgtggctgccgcccaggcctcccag
aaggcagcgtcggcagcttcagcggcatcagagggaaatcgaatgcagctacgtacgaga
aaggccaaagcttctctgcctagcagtcccaaggcggagactccaaagaaaaatgttacg
aagagcactcggaggactactatcgaccctggagacctgccaagttcaactgctgatagc
tcgcctggcgtcaggacaactcggagaaagagcacaacgccgatcgcttctaagccttcg
ggtgcagccgagtctggtcggcccaatacgagctcgttagacgttggggcaagcgaaaca
cccgaacaagcaagcatagctgcaggtagctgtcctccggagtctcctagccgcagcagg
tcgagtactccgtcacggtccgctgctcccaaacggtccgagggtcccaaggtgcctcct
gtaccgcgcgtgccgtctagttttctctcaaagccagccagtagcgatgatcagaaagtc
gtctccgaccaagcacaagcagaaatgacggagaagacggattccagaccggcagatttg
gacgatttggcagccggcgtgaagaaattgagcatcaaattgaaggtacctacccctgaa
gaacacgccgctcgcgagaaacagagaaaaacgacaaaagcggcaaaagcgacagagcaa
catcaaagacgcgctccaagaccgacaacatccaagacaccaacgtcctccaagaaagcc
tcaagcgtcaccgcggccgcgaccgcgcatgcttccactgccagaggaacctctcaccct
tcgccgagtcctagcacctcccagatgccttttggtccgaatatagccatctccaacggg
aacatggatcgggtgaagcaagaaagcccggaaaatgcaccagacgatcttgttgtctct
tctcctgatccgctggcggaaaatgaaactcctttgttgagcaatgtcactatcaatcgc
cctcgctgggaaacacccaaggatgtgttagtatctggttctgtctcgacgcaggaagct
ccttctggctcagcaaccccgtcctcgtgggcttcagaatccctgcctggtcgatctacg
gtatactcacctccaacaaccacgcgtcagacaatgaatggacttcccgtttttacgtcc
agctgccctattccttttgcggcagcaagcaccgctcctgaggggaagcaggctttagcc
atgcagcagccaaaccttttcacccacagtgataatgcagggactggtcatccggatctc
atgcataatcaaaactataaacccgaacaaccctga

DBGET integrated database retrieval system