KEGG   Aspergillus fumigatus: AFUA_4G10130Help
Entry
AFUA_4G10130      CDS       T01017                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
afm  Aspergillus fumigatus
Pathway
afm00500  Starch and sucrose metabolism
afm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AFUA_4G10130
Enzymes [BR:afm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AFUA_4G10130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF1966 Glyco_hydro_31 Glyco_hydro_70 hDGE_amylase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 3509344
NCBI-ProteinID: XP_751813
UniProt: Q4WPQ9
LinkDB All DBs
Position
4
AA seq 494 aa AA seqDB search
MHIRWSSFFLSCLAGTALAATPAQWRSQSIYFLLTDRFARTDGSTTASCDTSARYCGGTW
QGIIEQLDYIQGMGFTAIWITPVTKQLPQDTSEGTAYHGYWQQDIYSVNSNYGTADDLKA
LASALHDRGMYLMVDVVANHMGYAGAGDSVDYSVFNPFNSQTSFHPLCFISNYDNQTDVE
NCWLGDNSVPLPDLDTTNPDVQKIWYNWVNSLVSNYSIDGLRIDTVKHVQSDFWPGFNDA
AGVYCIGEVFDGDPAYTCPYQEVLDGVLNYPIYYPLLKAFQSTSGSMSSLYDMINTVKSQ
CADSTLLGTFVENHDTPRFASYTKDMALAKNAAAFIIFSDGIPIIYAGQEQHYSGGADPA
NREAVWLSGYSTTSDLYKLIATANAIRSHAISKDPGYVTYKNNPIYKDTSTIAMRKGSDG
AQIITVLSNLGASGSSYTLSLGGTGYEAGQQLTEMFSCTTVTVGSDKKVPVSMASGLPRV
FYPTAGLNGSTVCT
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcatatacgctggtcatccttttttctttcttgccttgctggaacagctttggcggcc
actccagcgcaatggcgatcccagtccatctatttcttactcacggatcgattcgcaagg
actgacggttccacaacggcctcgtgtgatactagtgctcgatattgtggtggtacatgg
caaggcattattgaacaactcgattacatacaaggcatgggctttacagcaatttggata
accccagtcaccaagcaacttccccaggatacgtcggaaggcactgcataccacgggtac
tggcagcaagacatttattcggtcaattccaactatgggaccgctgacgacctgaaagcc
ctggcgtcagctcttcatgacaggggcatgtatctcatggtcgatgttgttgccaatcac
atgggatatgccggtgcaggcgattcggtcgactatagtgtcttcaaccccttcaactcc
cagacctccttccacccattgtgcttcatcagcaattacgataatcagacagacgtggaa
aattgctggttgggggacaattcggttcctttacccgatcttgatactacaaatccggat
gttcaaaagatttggtacaattgggtgaactctttagtgtctaattattccatcgacggc
ctacgaattgacactgtgaagcacgtccagagcgatttctggccgggattcaatgacgcc
gcaggcgtctactgtatcggggaggtatttgatggagatccagcgtacacttgtccctac
caagaggtcctggacggggtgctgaattaccctatatattatccgcttctgaaagccttc
caatccacaagtggcagtatgagcagcctctacgatatgatcaacacggtcaagtcgcag
tgcgccgattcgacgctgttgggcacctttgtcgaaaatcacgatactccccggttcgca
tcgtataccaaggacatggccctcgctaaaaacgccgcagcattcatcatcttctccgat
ggaatcccaatcatctacgccggccaggagcaacattacagcggcggcgcggatcccgca
aaccgtgaggcagtctggctatccggctactcgacaacgagtgacctatacaagctcatc
gcgacagcaaacgccatccggagtcacgccattagcaaggacccgggatacgtgacttat
aagaataaccccatctacaaagatacctccaccatcgccatgcgaaaaggctccgacgga
gcgcagatcatcaccgtcctctcgaacctcggtgcttctggaagctcttacacgctctca
ttgggtggaacaggctatgaggccggacaacaactgactgagatgttctcctgcaccacg
gtgaccgtgggctcagacaaaaaggtccccgtttccatggctagtggcttgccccgggtg
ttttacccaacggctgggctgaacggaagtactgtttgtacttga

DBGET integrated database retrieval system