KEGG   Aspergillus fumigatus: AFUA_4G11770Help
Entry
AFUA_4G11770      CDS       T01017                                 

Definition
(RefSeq) glutathione transferase
Organism
afm  Aspergillus fumigatus
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 3509729
NCBI-ProteinID: XP_751653
UniProt: Q4WQ69
LinkDB All DBs
Position
4
AA seq 706 aa AA seqDB search
MDGADLQRFRVDSHPSDEQPRSLSSLADDAAALAATQHQHHQSHTQELADPQDAQSLQPL
QTALEHSELHLHHPQKQQHHQNAGHPLNIPASMQPPSRPGEPVNTELISPRQFNEKLHNY
HQASREHTFPGSLSDGQQTQSCLSHSGNQDGHHEQVLSQVRSDLAHTAVECNGNGADDVT
HMRNTSLQVSPSYPHHLQLQPQSNGYSVAPELSRQDGCLKDMKLVPNPPDLEYWREKLFN
VDETITLTEDQFRTYFPHVDNVYSHRSTQRYKRKPFVSHYWDCRLKGRPPGTPKSDDPNK
KKRKRTARQRDLCDVKIKITEYFPGYGVAAVSDFAATGPETSFPSSEFLPSVNSLFHESS
ALGQRRGSQPFGVLTPNPTLPEDHPGANGERFFTIQRVNGNGANGKNDGVGGGHRHTLEE
SDRVKKNSVQRYLLKEAKEKKKTGSVSVRSISKTRTMPSQSEAQQKTYHTKATGLAALTA
INHSNEAELKLFGSCFCPFVQRVWIALEIKGIPYQYIEVDPYQKPQSLLEVNPRGLVPAL
RHGDWGSYESSVLLEYLEDLGVGPHLLPPGDAKLRAHCRLWTDHINRHIVPSFYRVLQEQ
EEQKQTANVQELQDGLKALITAANPEGPFFLGPTISFVDVQIAPWILRLSRVLKPYRGWP
DPEPGSRWAAWVNAIEANEHVKATTSSDELYLDSYERYARGYTFTA
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggacggtgcggatcttcagcgattccgcgtcgactcccacccttctgatgaacagccc
cgatcgctgtcctccctggcagacgacgcggccgctttagctgcaacccaacatcagcat
caccagtcacatacacaagagcttgcagatccccaggacgcgcagtcgctgcagcctcta
caaactgcgctcgaacactcggagctccatctccaccacccgcagaaacagcagcaccat
caaaatgcgggtcatccgctcaatataccggcgtcgatgcagccgccgtcacggcctggc
gagccggtcaacaccgagctaatatctcctcggcagttcaacgagaagctgcacaactac
caccaagcatcccgagagcacacattcccgggtagcctttcggatggccagcagacgcaa
tcctgtttatctcacagcggcaatcaagatggacaccacgagcaggtcctgtcgcaagta
cgttcggatcttgcacataccgctgtcgagtgcaatgggaatggggccgacgatgttacg
cacatgcgcaacaccagcctgcaagtatcgccgtcctatccgcatcatttgcagctacag
ccgcaaagtaacggctactccgtggccccggaactctcgagacaagatggctgtctgaaa
gacatgaaactggttcctaatcctccggaccttgaatactggagggaaaaactattcaac
gtggacgagacaatcaccttgacggaagaccaattccgaacctacttcccgcacgtcgac
aacgtctactcccaccgctccacacagcgctacaagcgcaaacccttcgtctcccactac
tgggactgcagactcaaaggccgcccgcccggaacccccaaatccgacgacccgaacaaa
aagaagcgcaaacgcaccgcccgccaacgagacctctgcgatgtcaagatcaaaatcacc
gagtacttccccgggtacggcgtggctgctgtatcggactttgctgccaccgggcccgag
acctcctttccttcctcggagtttctgccgagcgtgaactcgttgttccatgagtcgtcg
gccttggggcagaggaggggcagccagccgttcggcgtgctcacgccgaatccgacctta
cctgaggatcatcccggggcgaatggggagagattctttacgatccagcgggtcaatggc
aatggtgcgaatgggaagaatgatggggtgggcggaggccatcggcatacgttggaagag
agcgaccgggtcaagaaaaacagtgttcagcgctatttgctgaaagaggccaaggagaag
aagaagacaggctcagtaagtgtgcgatctatttctaagactagaacgatgccctcccaa
agtgaagcccagcaaaaaacataccacaccaaagctactggcttagcggccttgaccgct
ataaatcattccaatgaagcagaactcaaactgttcggaagttgcttctgcccttttgta
caacgcgtttggattgccttggaaatcaagggtatcccataccaatatatcgaagtagat
ccataccaaaaacctcaatctctgttggaggtgaacccaagaggcctggtgccagcgttg
cggcacggtgactgggggtcgtatgaaagttcggtcctgctcgaatatctcgaagatttg
ggcgttggtccgcaccttttgccaccgggcgatgcgaagttgcgagctcactgtcggctc
tggaccgaccatatcaatcgtcacatcgtgcccagcttctatagggttctccaggaacag
gaggaacaaaagcagacggcgaatgtgcaggagctccaagacggtctcaaggcgctaatc
acggctgccaatcccgaaggtccatttttcctgggaccgaccatctcctttgtggacgtc
caaatcgccccttggatcctccggttgagccgagtgctcaaaccctaccgtggctggcca
gaccccgagcctggaagccggtgggcagcatgggttaatgcgattgaggccaatgagcat
gtcaaggcgacaactagctctgacgagttgtatcttgacagctatgagcgatatgcccgt
gggtataccttcacggcgtga

DBGET integrated database retrieval system