KEGG   Aspergillus fumigatus: AFUA_5G06000Help
Entry
AFUA_5G06000      CDS       T01017                                 

Definition
(RefSeq) SET and WW domain protein
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
afm  Aspergillus fumigatus
Pathway
afm00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    AFUA_5G06000
Enzymes [BR:afm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AFUA_5G06000
Chromosome and associated proteins [BR:afm03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     AFUA_5G06000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET Med26 WW
Motif
Other DBs
NCBI-GeneID: 3511090
NCBI-ProteinID: XP_754032
UniProt: Q4WTT2
LinkDB All DBs
Position
5
AA seq 966 aa AA seqDB search
MSSHDNADSPSSSVANAVTAMKIEQHDGAADMLLSNGGDAVLKRDSNGLSEHAVTAKDYP
GMNDLASSTVKSRTSSLTPIKTENGDSTAKEEKVGGDITVKMEPGQPPKLSRSSSQKVVA
QPPQLFLHLPDSTAEAQSTFEVMETCTYANKYMGYTEHAMECDCAEEWEPSLSRNLACGE
DSDCINRATKIECVGDCSCGAECQNQRFQRKEYANVAVIKTEKKGFGLRAETDLRPHQFI
FEYVGEVINEAQFRRRMRQYDEEGIKHFYFMSLSRGEFVDATKKGNLGRFCNHSCNPNCY
VDKWVVGEKLRMGIFAERAIQAGEELVFNYNVDRYGADPQPCYCGEPNCTGFIGGKTQTD
RATKLSNATIEALGIEDADSWDTVVAKRPRKKKMGEDDEEYVDSVQPKSLDENGVTKVMA
ALMQCKEKWIAVKLLRRIERCDDDRVRHRVVKMHGYQILNSQLTLWKDDFNVVLQILNIL
DGFPRLTRNKIIDSKIESTVQPLTTCGDERVEKKAAALLQHWATLEVGYRIPRMKRDPNA
VASVSQFGRREHTTDEQKRSQSRSRSRSPSLDAPRGPANPGRKSNGPRNSQHHGARQFRR
QFNPLPPGWFAAESHGRTYYYCARGDVTWTRPIHAAPEAEVPGQQAKNKALQGIIDNILN
AKENTPKEKTVTPGTPQASRETASLNEGQERWRSYSEEKQKKLYENTLFPHIKYVVDKFK
HKLPKEDLKRYAKDVAKKLVNSDFKNNRVEDPTKISEKQQKKVKAFCKEFFDKAVAKHRA
YEQRKAEKQAKGGNSKADDMISGHNTVEDDVKLSDGEAEKVEENDNSMSSDPQGILKRKR
EDEMDIGEGAAEEAMKRQKSSTPIPPPPPPPPPLGDEEQPTPNGTGEDDFLAENGVSMLH
SPGSAPTPPPPPPLSTEHSDNDEMGQSPSMSNHLLEQKSFPAPLGEEYEADSGKLSSNRI
GIEGQV
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctcatgacaacgcggactcaccctcatcttctgtagctaatgcggtgaccgcg
atgaagattgagcagcatgacggcgccgcagacatgctcctctccaacggtggagacgcc
gttttgaaacgtgattccaacgggttatcagagcacgctgtcaccgccaaagattaccct
gggatgaatgatctggcatcatccactgtcaaatcgcggacttcatctctaactccaatc
aaaaccgaaaatggagattccacagccaaggaagaaaaagtcgggggcgatatcactgtc
aagatggaacccggtcagcctcctaagttatcgcgcagctcttcgcagaaggttgttgcg
caaccccctcagctatttttgcatttgccggacagcacggcggaggcacaatcaaccttt
gaagtgatggaaacttgtacctatgccaataaatacatgggttatactgagcatgccatg
gaatgcgattgtgctgaggaatgggagccgtcgttgtccaggaatctggcatgtggggaa
gattctgattgcatcaatcgcgctaccaaaatcgagtgcgtgggagattgcagctgcggt
gccgaatgccagaatcaacgattccagcgcaaagagtatgcaaatgttgcggttatcaag
acggaaaagaaaggcttcggccttcgtgccgagactgatttgcgaccgcaccaattcatc
ttcgaatatgtcggcgaagtcatcaacgaggctcaattccggcgacgcatgagacagtat
gatgaagaagggatcaaacacttctatttcatgtcccttagtagaggagaatttgtcgat
gcgacgaagaagggcaatctgggtcgtttctgcaaccactcgtgtaatcccaactgttac
gtcgataaatgggttgtgggtgagaaattgcgtatgggaatatttgccgaaagagctatc
caggccggcgaagaactcgttttcaattataacgtcgatcgttatggcgcggatcctcaa
ccatgctactgtggcgaaccgaattgcaccggctttattggaggaaagactcagaccgat
cgtgctaccaagctttctaatgccaccattgaagctttgggtatcgaagatgctgatagc
tgggacactgttgttgcgaagcggccgcgaaaaaagaagatgggcgaggatgatgaggag
tatgttgatagcgtacagcctaagtccctagatgagaacggcgtcaccaaggtcatggcg
gccctcatgcaatgcaaagaaaaatggattgctgtcaaattgctgaggcggatcgagcgc
tgcgacgatgaccgagtccgccatcgtgtggtgaagatgcatggctaccagatattgaat
tcccagctcaccttatggaaggatgacttcaacgttgtgttgcagatcctcaatattttg
gacgggtttccccgtcttacacggaacaagattattgattcaaagatcgaatccaccgtc
cagccgctgacaacttgtggagatgagcgagtcgagaagaaggccgccgcacttttgcag
cactgggcgactctggaggttggatatcgtatccctcgcatgaagcgagatccaaatgcg
gttgcttcggtcagccagttcgggcggagagagcatactactgatgagcagaaacgctct
caatctcgttcacgatcaagatccccgtcgttggatgctcctcgagggccagcgaatcca
ggtcggaagagcaatggccccaggaattcccagcatcacggtgcccgtcagttccgccgc
cagttcaatcctctgcccccgggatggtttgcagccgaatcacacggcaggacttattat
tactgcgcccgtggggatgtcacctggactcggccgattcatgccgcacctgaggccgaa
gtcccaggccaacaggcgaagaataaagccctacaaggtattatcgataatatcttgaat
gctaaggagaacacgccgaaggagaagaccgtcacacctggcacgccgcaagcttctaga
gaaacggcaagtctcaatgaagggcaggagaggtggagaagttacagtgaagagaaacag
aagaagctgtatgagaacacgcttttccctcatatcaaatatgtggtggacaaattcaaa
cacaagcttccgaaagaggacctgaagcgctatgctaaagatgtcgccaagaagctcgtc
aactccgacttcaaaaacaatcgcgtggaagatccaacgaagatcagcgaaaagcaacaa
aagaaagtcaaggccttctgcaaggaattctttgacaaggctgttgcgaagcaccgtgct
tacgagcagaggaaggccgagaagcaggcaaagggaggcaactcgaaagcagacgatatg
atcagtggacacaacaccgtcgaagatgacgtgaagttgtctgacggcgaagcagaaaag
gttgaagagaatgataactccatgagcagcgatccgcaaggcatcctcaagcgcaagagg
gaagacgaaatggatatcggtgaaggggctgctgaagaagcgatgaagagacagaagtca
tcaacgcccatacctcctcccccaccgccaccgcctcctctgggtgatgaagagcaaccc
acaccaaatggcactggcgaagatgacttcctggctgagaatggtgtttcaatgctgcat
agcccggggtctgcgccgactccccctcccccgccacccttatcaacggagcacagtgac
aacgatgaaatgggccaatcccccagtatgagcaatcatctgttagaacaaaaatctttc
cctgcgcctctgggagaggagtacgaagccgactcaggaaagctttcgtcaaaccgaatt
ggtattgagggtcaagtataa

DBGET integrated database retrieval system