KEGG   Aspergillus fumigatus: AFUA_5G06420Help
Entry
AFUA_5G06420      CDS       T01017                                 

Definition
(RefSeq) MAP kinase kinase kinase SteC
  KO
K11228  mitogen-activated protein kinase kinase kinase [EC:2.7.11.25]
Organism
afm  Aspergillus fumigatus
Pathway
afm04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:afm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    AFUA_5G06420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:afm01001]
    AFUA_5G06420
Enzymes [BR:afm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     AFUA_5G06420
Protein kinases [BR:afm01001]
 Serine/threonine kinases: STE group
  STE11 family
   AFUA_5G06420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Ras_bdg_2 SAM_1 SAM_2 Kinase-like RA Pkinase_fungal Kdo MSA-2c SAM_4
Motif
Other DBs
NCBI-GeneID: 3511312
NCBI-ProteinID: XP_753991
UniProt: Q4WTX3
LinkDB All DBs
Position
5
AA seq 973 aa AA seqDB search
MLATKIQLSAPLGMTGSQATAPTYHVGPSHKSSMGASSQDGMLFTSPTESEFSLKDGHDA
VRSWDEKQVINWLHSINCGQYESLFRANNFNGNNLIECDQKILQEMGIKKVGDRVRIFVA
IKKLRNKSVNNLRQTNMVSENLSQLEPQLTPKKNQLAALEAPTYAPTSDSSRLTNLRQRS
SSNRRMSRLVDNGYSTGKSSSRPGSPLRNQRYAANSPMESGRKEGYFAHPSTGGSNSGRN
PGTPSDGSHGHKGGVHLRQNPSIDGLTMGALPANSPVIRVIYTGGQTKVLDIKHCKTADE
IILCVLKKLQLPEHQYRNYCFYVLDGLEPDPSNCRRLTDQELMEICEGSSRSERGRLILR
KIHAGEPDTDELRRASQLALDESQMTHMNALSSSNVRNQIKIQQLTGEPWHHIKQPLSPV
SARQPQAHNDHDQSLQMSTERPSVAKLRSFFGARPPSEMIIHELTSYFPGHQREDIEKTM
RMSIRRSQRLSRAASRLSVLSNTSYASSLRDAPPIPSIADTWLNPGAPSTRASRPLSVSR
FNLPQTSYRDSIASSSLQPLQEESPIEPNRKSYVSFDSGSDDPSNSRQSLLDENASVAAT
DGGSFNERLSVLVAEDGEEEDDGLNEFLSGNNFAPKNWMKGSLIGEGSFGSVFLALHAIT
GELMAVKQVEIPSATKGTEFDKRKNSMVTALKHEIELLQGLHHPNIVQYLGTSADDQYLN
IFLEYVPGGSIATMLKQYNTFQEPLIKNFVRQILEGLSYLHSRDIIHRDIKGANILVDNK
GGIKISDFGISKRVEASTVLGARASGNGGGHLHRPSLQGSVYWMAPEVVRQTAHTKKADI
WSLGCLVVEMFIGAHPFPDCSQLQAIFAIGSNSARPPAPEHASKEAMAFLDMTFQVDYEK
RPSADELLQSPFLSAPLACFPESSFFSFRRHTEFCIFPFYGLEYPRAFPSYCSLSSYHLL
NARLSPQRRFNIR
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgacgaagattcaattgtcggcgccattgggcatgacaggatcccaggctaca
gcacccacatatcatgtcggaccatcgcacaagtcgtcaatgggggcgtcttcgcaggac
gggatgctgtttacaagcccgacagagtcggagttttccttgaaggatggtcatgatgcc
gttcggtcgtgggatgagaaacaagtgataaactggttgcacagcataaattgcggccag
tacgagtctttattcagagcaaacaatttcaacggaaacaatcttattgaatgtgaccag
aaaattcttcaggaaatgggcattaagaaggtcggcgatcgagtgcggatttttgtagcc
attaagaagctcagaaacaagagtgtcaacaatcttagacaaacgaacatggtaagtgag
aatctgtcacagttggaacctcagcttacccccaagaagaatcaactcgctgcacttgag
gcccctacgtacgctccaacttcagattcatctcggcttaccaacctccgccaacgaagt
tcgagcaatcgtcgtatgtctcgcttagtcgacaatggttactccacgggaaaatcatca
tcacgcccagggtccccattgagaaatcagcggtatgctgcgaacagcccgatggaaagt
ggtcggaaagagggttatttcgctcatccttccactggcggctcaaattctggccgaaac
ccaggaacacctagcgatggtagccatggccacaaaggtggcgtacatctgaggcaaaac
cccagcattgatggactgacaatgggtgctttgcccgcaaattcgccagttattagggtc
atatataccggcggacagaccaaggtactggatatcaagcattgcaagaccgccgatgag
attatattgtgtgtcctcaagaagctgcagctaccggagcaccagtatcgcaactattgc
ttctacgtgctggacggcttggaaccagatccttcgaactgtaggcgacttacggatcag
gagctcatggagatttgcgaaggatcaagtaggtccgagcgcggacgtctcattctgcgg
aaaattcacgctggcgaaccggatactgatgagcttcgtcgtgcttcccagcttgcgttg
gatgagagccaaatgacacacatgaatgctctgagcagttcaaatgtgcgcaaccagatt
aaaatacagcaactcacaggtgaaccctggcatcacatcaaacaacctttgtcgcctgta
tctgcccggcaacctcaggctcataatgaccatgaccagtctctccaaatgagcactgaa
cgtccctctgtggccaagttgcgatctttcttcggggctcgcccacctagcgaaatgatt
attcatgaacttacatcatattttcccggtcatcagcgtgaggatattgaaaagaccatg
cgcatgtcgatccggagatctcaacgtctcagccgagcagcaagtcgcctgagcgtcctc
agcaatacaagctatgcatcgagcttgagggatgcccccccgattccgagtatcgctgac
acctggctcaatcctggagcaccatctactcgcgcctcgaggccgctctcggtttcccga
ttcaatctcccgcaaacatcatatagggattctatcgcctcaagctctcttcagcctctt
caagaggagtctcctattgagccgaatcgcaaatcatatgtttcctttgatagtggctca
gatgatccgagtaactctcgccaaagccttcttgatgagaacgcgagtgttgcagcgaca
gacggcggatccttcaatgagaggctgagtgtattggtggccgaagatggagaagaggag
gacgatggcctcaacgagttcctttcaggcaataattttgctcccaaaaactggatgaag
ggatctttgattggtgagggatcttttggtagtgtcttccttgctcttcatgcaatcact
ggagagctcatggctgtcaaacaagtggaaataccttcggcgacgaagggtactgagttt
gacaagcgcaagaacagcatggtgacagcacttaaacatgagattgagctgttgcaaggg
cttcaccatccgaatatcgtccagtatttgggcacctctgcggacgatcagtacctgaat
attttcctggagtacgtccccggcggttcaattgctacgatgctcaaacagtacaacacc
ttccaagagccgctgatcaagaattttgtacgtcaaatattggaaggtctttcctacctc
catagccgagacatcatccaccgtgatatcaagggtgccaacattctggtggataacaag
ggcggtatcaagatttccgactttggcatttccaaacgtgttgaagcctccactgttctc
ggtgcccgagccagcggcaacggaggtggccatcttcatcgaccttctctacagggaagc
gtgtactggatggcgccggaagtcgtgcgacagacagcccacacgaagaaggcggacatc
tggagtttgggctgccttgttgttgagatgtttattggggcccatcctttccctgactgc
agtcagttgcaagctattttcgccattggtagcaacagtgcaagacctccggctcccgag
cacgcgagcaaagaagccatggccttcttggacatgaccttccaagtcgattatgagaaa
agaccctccgcggatgagctactgcagagcccatttttgtctgcaccgctggcgtgtttc
cccgaatcaagtttcttttcatttcgaaggcacaccgaattctgcatcttccctttttat
ggacttgaataccccagagccttcccgtcttattgttcgctttcttcttaccatctccta
aatgcaaggctatcacctcaaaggcgttttaatatccggtag

DBGET integrated database retrieval system