KEGG   Aspergillus fumigatus: AFUA_5G12050Help
Entry
AFUA_5G12050      CDS       T01017                                 

Definition
(RefSeq) DNA ligase
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
afm  Aspergillus fumigatus
Pathway
afm03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:afm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AFUA_5G12050
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:afm03400]
    AFUA_5G12050
Enzymes [BR:afm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AFUA_5G12050
DNA repair and recombination proteins [BR:afm03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     AFUA_5G12050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C BRCT_2 RNA_ligase BRCT LIG3_BRCT DNA_ligase_IV RTT107_BRCT_5
Motif
Other DBs
NCBI-GeneID: 3511447
NCBI-ProteinID: XP_753446
UniProt: Q4WVG8
LinkDB All DBs
Position
5
AA seq 979 aa AA seqDB search
MDSDEIMPDEEHPNVPVGDEESDIDEKYPNRPRNHSPTLPFHELFQTLFNPLGEIKKKPA
GAVAARRKVGPHGQSAANLNPLERRRDVIERFISRWRKEVGDDIYPAFRLILPDKDRDRA
MYGIKEKAIGKMLVKIMKIDKNSEDGFNLLNWKLPGQAATSRMTGDFAGRCFDVISKRPM
RTDVGDMLIEEVNEKLDKLSAASKEEQQLPILAEFYRRMNPEELMWLIRIILRQMKVGAT
ERTFFDVWHPDAENLYSISSSLRRVCWELHDPNIRLDAEDRGISLMQCFQPQLAQFQMDS
LDRMVARMRPTEEDPVFWIEEKLDGERMQLHMASDDSVPGGRRFRFWSRKAKEYTYLYGN
GIYDENGSLTRYLKDAFADGVQSLILDGEMITWDPEQDAPAPFGTLKTAALSEQRNPFST
TGARPLLRVFDILYLNGRDLTGYTLRDRRKALQKAVRPVHRRFEIHPYEEATTKDQVEAA
LRKVVAEASEGLVLKNPRSPYRLNERHDDWMKVKPEYMTEFGESLDLIVIGGYYGSGRRG
GNLSSFLCGLRVDDGHASQGASASKCYSFCKVGGGFNAADYANIRHHTDGKWMEWNPKKP
PTAYIELAGRDAQYERPDMWIKPEDSVVICVKAASVSASDQFRLGLTLRFPRFKRLRMDK
DWKSALSVQEFLDLKSNVEQEHREKELNVDNSRRKRVKRTAKKPLTVAGYDMDEDVKYAG
PSGHIFDGLNFYILTDSSAPIKKTKPELEQLVKANGGMFFQTNNAAPHTICVADRRTVKA
ASLQKRGDVDIIRPSWIIDCVKQNEIDAGLPDFLLPFEPRHMFFATPGKHDEVASNVDQF
GDSYARDTTSEELSDCPESITKLIERLQESVNSGHEMPCGLLFKSLTILFPHRNDDVSES
EAKTSSHPSITHVVIDPESSSKEISSLRGKWSRKPGRKVPHIVTVDWVEESWKSRTLLDE
ERFQPKRCISGIAKPYWPG
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atggactctgacgagattatgcctgatgaggagcatccaaatgttcctgtcggtgacgag
gagtcggacattgacgaaaaatatcccaaccggccccgtaaccattccccaaccctacct
ttccacgagcttttccagaccctcttcaaccctctgggcgaaataaaaaagaagccagcc
ggagcggttgcggctcgcaggaaagtcggtccccatgggcagtcagcggccaatctcaat
ccgctggagagacgacgcgatgtgattgagcgatttatctcgcggtggaggaaagaagtg
ggtgatgatatataccccgcctttcgactaattcttccggacaaggatcgggaccgggcc
atgtacggaatcaaggagaaggctattggcaaaatgcttgtcaagattatgaaaattgac
aagaactccgaggatggctttaacctgttgaactggaagctgcctggacaagcagctacc
tccaggatgacgggcgactttgcggggcgatgtttcgatgtcatctcgaagcgacccatg
cggactgatgtgggagacatgttgattgaggaggttaacgagaagctggacaagttatcg
gcggcttccaaggaggagcagcagctgcccatccttgcggagttttaccgacgcatgaat
cccgaggaactcatgtggttgattcgtatcatcctccggcagatgaaggtaggagcgacg
gagcggaccttctttgacgtctggcatccggacgcggagaatctctacagtatttcgagt
agtctccggcgtgtctgctgggagctacacgatccgaatattcggctggatgctgaggac
agaggaatcagcctgatgcagtgcttccagccgcagctggctcagttccaaatggattcg
ttggaccgcatggtcgctcggatgagaccgacggaggaagatcctgtcttctggatagag
gagaagctggatggcgagcgcatgcagcttcatatggcatctgacgattcagtacctggc
ggcagacgattccgtttctggtcaagaaaagcgaaagaatacacatatttatacggcaat
ggtatttatgatgaaaatgggtctctgacgaggtatctcaaggatgcttttgcagatggg
gtccagagcctgattctggatggtgaaatgatcacatgggaccccgagcaagacgctccc
gcacctttcggtacactcaagactgctgcattgtctgaacagcggaatccgttctccacg
acaggcgctcggccgctgctacgtgtctttgacatactgtatcttaatgggcgagactta
actggctacacacttcgtgatcgtcgcaaagctttgcagaaggctgtccgccctgtccat
cgcagatttgaaatacatccctacgaagaagctacaactaaagatcaggtcgaagctgcg
cttagaaaggtggtagctgaagcttccgagggtttggtgctcaagaaccctcggtcacct
taccgcctgaacgagagacacgatgactggatgaaggtgaagcctgagtacatgaccgag
ttcggagagtctttagatctcatcgtcatcggtgggtactatggctccggtcgtcgaggc
ggcaacctttcaagttttctttgcgggctaagagttgacgatggccatgcctctcagggt
gcgagcgcgtcaaagtgctactccttctgcaaagttggaggtggctttaatgccgctgat
tatgcaaatatccgtcatcacaccgatggtaaatggatggagtggaacccaaagaaacct
ccaacggcgtatatcgaattggcaggtcgagatgctcaatatgagcgaccggacatgtgg
atcaagccggaagactcagtcgtcatctgtgtcaaagcagcctctgtatcagctagtgac
cagtttcggcttgggctgactttgcggtttccacgtttcaaaaggctgcgcatggacaaa
gattggaaaagtgctctgtctgtgcaggaattcctagatctcaagtcgaacgttgagcag
gagcaccgggaaaaggaactgaacgtggacaattcccgtaggaaacgcgtcaagaggaca
gcgaagaagcctctcacggttgctggatacgacatggacgaagatgtcaagtatgctggt
ccatctgggcatatatttgacggattgaacttttatattctgacagattcgagtgcgccc
atcaagaaaacaaagcctgagctagagcagcttgtcaaagctaacggtggcatgttcttc
caaactaacaatgcagctcctcatacaatctgtgtggcggacagaagaacggtaaaagct
gcctcgttacagaagagaggcgatgtggatataatccggccgtcctggattattgattgt
gtgaagcagaatgagattgacgcggggctacccgacttcctgctcccttttgagcctagg
cacatgttcttcgccacgccgggcaagcacgacgaagtggcatccaatgtagaccaattt
ggcgatagttacgctcgtgacactacaagcgaggagctcagtgattgtccagagtccatc
acgaaactcattgaacgcctccaagaaagtgtcaattccggacatgaaatgccatgtggg
ttgctcttcaagagtcttacgatactcttcccacatagaaatgacgatgtgtcagagtct
gaagccaagacctcaagccatccctcgatcacccatgtcgttatagatccagaaagctcg
tcaaaagaaatatcttcactacgagggaagtggtccagaaagcctgggaggaaggtacca
cacatagtcactgttgactgggtagaagagagctggaaaagtcgaacgctattggacgag
gagagattccagcccaaacgatgcatatctggcatcgctaaaccgtattggccaggatga

DBGET integrated database retrieval system