KEGG   Aspergillus fumigatus: AFUA_6G06335Help
Entry
AFUA_6G06335      CDS       T01017                                 

Definition
(RefSeq) SET domain protein
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
afm  Aspergillus fumigatus
Pathway
afm00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    AFUA_6G06335
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:afm03036]
    AFUA_6G06335
Enzymes [BR:afm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AFUA_6G06335
Chromosome and associated proteins [BR:afm03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     AFUA_6G06335
   HMT complexes
    COMPASS/SET1 complex
     AFUA_6G06335
    COMPASS/SET1 complex (yeast)
     AFUA_6G06335
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET_assoc SET RRM_1
Motif
Other DBs
NCBI-GeneID: 3508771
NCBI-ProteinID: XP_750524
UniProt: Q4WNH8
LinkDB All DBs
Position
6
AA seq 1241 aa AA seqDB search
MSRTSAGFADFFPTAPSVLQQKRVRAPRDRPCPKDRPEDQLHVQDDNGQSSCSPGTSAAN
VSTNGSPPSVSVSETGTGVENSGCKLVGETNTDITGTDTSILSASLAQCRATQVNEARFD
NLTPVTNAESSPPRKLSPHQSKSVEVAEYESNKFATDESKLAATPLHTPPTPRSQTSRSG
VIKGCKLVYDPDLEKRSSKEKRRKPQYVDFVVNEQDGCSPDPRLSILNYTRGAGCKQKTK
YRPAPYRLKQWPYDTATTIGPGPPVQIVVTGFDPLTPVAPINALFSSFGEISEINNRTDP
ITGRFLGVCSVKYKDSTSFRGAGPVPAATAARRAYVECKKEQRIGTRRIRVELDRDGAVS
DRIVARAIESQRMGHKKNIVGEEAKVEPQAKKNEPPPTAPKGPSRSSTRPVAAVPEGPRA
SFLKPAIPSLIEETPILAQIKRDPYIFIAHCYVPVLSTTIPHLKKRLKLFDWKDIRCDKT
GYYIIFENSRRGEEETERCFKVCHMKPLFTYIMNMESQPYGNPNYERSPSPERLQAERRE
RAERERLKKEADLDLEEEKKQRAIDLDPCREVLALIVRDLKDKLLEDVKSRIAAPTLYDY
LDPDRHAARRRALGIPDPEGIRRHTFRLDADNFGSNNPRSFLPGDRSFSPYGLNILALPR
IRKARRLNRANAAFLDERRKQPVRRKEVRPLYHRLQQLHDVDDSDEDQRTPFSRDIDEQD
SRPPSRMSSRSSISDDGEESEPLDGLAPQGKRHESRLLGLEYEDSGNTLNEAVDGYSRHD
SPGLSSTRKRKRVAEGIDVRKRPKEESERSQLNRSVEAGDTFYEESQHSEAAELGTVKPE
NLAGIGGKFLGRVEDRSINEDGEKENMERLHIESAIQGANLGIQQPLPDESTTTKSHEDP
ITEIEWGVSNDEPRPTVVDDETIILDLDGWQNLVKDEEDLCFLRHVLDGQSRSKVGNLSA
WAWRQKEIKALNRAGESGPVHQETRIPDYYVCNPTGAARTEGRKRILESEKSKYLPHRIK
VQKAREEREANAKSDPHASSAAEAARISAAKTISKSTSRSTRVNNRRLVADINAQKQALP
MQGGDGDVLRFNQLKKRKKPVRFARSAIHNWGLYAEENISANDMIIEYVGEKVRQQVADM
RERQYLKSGIGSSYLFRIDENTVIDATKRGGIARFINHSCTPNCTAKIIKVDGSKRIVIY
ALRDIGRDEELTYDYKFEREWDSDDRIPCLCGSTGCKGFLN
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcacatcggcaggctttgcggacttctttcccactgccccgtcggtccttcaa
caaaaaagagtcagagcgccgcgagatcgaccttgccccaaggatcggcccgaggatcaa
cttcatgtccaggatgacaatggacaatcgtcctgctctcctggaacaagcgcagccaac
gtttctacgaatggcagcccacctagcgtatcagtatcggaaaccggtacgggtgtagag
aactccggatgcaaactcgttggagaaacgaacacggacataacgggtacggatacatct
attttaagtgcatcgcttgctcagtgtcgtgcaacgcaggtgaacgaggcacggttcgat
aatcttaccccggtcaccaatgcagagtcgtctccgcctcgcaagttgagccctcatcaa
tccaagtccgttgaagtggccgaatacgaatcgaacaagtttgcaaccgatgaatcgaaa
cttgctgctacacccctacatacaccgccaactccacggtcgcaaacatcgcgcagtggt
gtaattaagggttgcaagttggtttacgaccccgatcttgagaaaagatcatcgaaagaa
aagagaaggaagccacagtatgtggactttgtggtgaatgaacaagatggctgttcacca
gacccacgtctgagtattctgaattacactcgaggtgctggctgtaagcagaagaccaaa
taccggccagctccttatagactgaaacagtggccctatgacactgcaactactatcggt
cccggaccccccgtccaaatagtggtcactggcttcgatcctctgaccccagtggctccg
ataaacgcgcttttttcaagcttcggtgagatttcagaaataaataatcgcacagacccg
attacaggtcgatttcttggagtatgttcagtcaagtacaaagacagcacctcttttcga
ggtgccgggccagtaccagcggcgaccgcggccaggcgagcctatgttgaatgcaagaag
gagcagcggattgggacacgaaggattcgggttgaactagatcgagatggtgctgtctca
gacagaattgttgcaagggccatcgagtctcagcgaatgggacataagaagaacatagtc
ggagaagaggcaaaagttgagcctcaagcaaaaaagaatgaaccaccgccgacagctccc
aaaggcccttcaaggtcttccacacgtccggtagcagctgtacctgaaggtccaagggcg
agctttctcaagcccgccataccctctctgatagaggaaacacccatattagcgcaaatc
aagcgggatccatatatcttcatcgcgcactgctacgttcctgttttgagcacaacgatt
ccgcatctgaagaaaagactcaagttatttgactggaaagacattcgatgcgataaaact
gggtactatatcatcttcgagaattctaggcgtggtgaggaggaaaccgagcgttgtttc
aaagtatgccatatgaagcccctttttacttacatcatgaatatggaaagccagccctat
ggcaatcccaactatgagcgaagtccgagcccagaacgactccaagcagagcgacgggaa
cgggctgagagagaaaggctgaagaaagaggcggatttggatctcgaggaagagaagaaa
cagcgagcgattgatttggacccatgcagagaagtcctggctctcatcgtccgcgatttg
aaagataaacttcttgaggatgtcaaatcacgcatcgccgccccaacattgtatgactat
ctcgaccctgacagacatgcagcaaggaggcgggctctgggcattcctgatcctgagggg
atcagaagacatacttttcgactcgatgctgataattttggatccaacaatccccggtct
ttcctaccaggcgaccgttcgttcagcccatatggccttaacatacttgcgctcccacgt
atccgaaaggctcgtcgtttgaaccgtgccaatgctgccttcctagatgagaggcggaag
cagcctgttcggagaaaggaagtacgtcctctctatcacagactgcagcagttgcatgat
gtcgacgactctgatgaggaccaacgtactccgttctcgagggatattgatgaacaggat
agtcgaccaccaagtcggatgagttccagatcttcaatttccgatgacggcgaggaatca
gaacccttggatggcctagctccccaaggcaaaaggcatgaatctcggctcctaggcttg
gaatatgaggatagcggtaacacccttaacgaagcagtcgacgggtattcccggcatgat
tcgcctggtctctcctctactcgtaaaaggaaaagggttgcggaaggaattgacgtgcgt
aaacgacccaaggaggaaagcgagcgatcacaattaaatcgctctgtggaggctggagat
acgttctacgaggagtctcagcactcagaagctgctgagcttggcactgtgaagccagaa
aacctcgctggcatcgggggtaaatttcttgggcgagtggaagacaggtcaatcaatgag
gatggtgagaaagagaatatggaacggctgcatatcgagtctgccatacaaggagcaaat
ctcggcattcagcagccattacctgacgaatccactactacaaagagccatgaagacccg
attacggagatcgaatggggggtgtctaatgatgaacctcgtccgacagttgttgatgat
gaaaccataatcttggatttggacggctggcagaatctcgtcaaagatgaggaggatctc
tgcttccttcgccatgttctggacgggcagtcgagatccaaggttggaaatctatcggca
tgggcttggagacagaaagagatcaaagctctcaaccgtgccggtgagagtgggccggtc
catcaagaaactagaataccagattactacgtttgcaaccccactggagctgctcggacc
gaagggagaaagagaatcttggagtcggagaagtcgaaatacctgcctcaccgtatcaaa
gttcaaaaggctcgagaagaacgggaggccaacgcaaagagcgatcctcatgcttcttct
gctgcagaagccgctaggatatccgcggcgaagacgatatctaaatctacttcgagatcg
acaagggttaacaatcgcaggctggttgcagacatcaatgcgcaaaaacaggctctccct
atgcaaggtggagatggtgatgttctccgtttcaaccagttgaagaaacgaaagaagcca
gtacgctttgctcggtcagccattcacaattggggtctgtacgcggaagagaacatatca
gcgaatgatatgatcatagagtacgttggtgaaaaggtgcgacagcaagtggcagacatg
cgggagaggcagtacttgaagagcgggataggtagcagctaccttttccgaatcgacgag
aacactgttatagatgccaccaagagaggaggtatcgctcgcttcatcaaccatagctgt
actcctaattgcactgcaaagatcatcaaggttgatggtagcaaaagaattgttatatat
gctctcagggacattggaagagatgaagagctgacctacgactacaaattcgaacgggaa
tgggacagtgacgacagaattccctgcctctgcggctcgacaggttgcaaagggttcctt
aattaa

DBGET integrated database retrieval system