KEGG   Aspergillus fumigatus: AFUA_8G00230
Entry
AFUA_8G00230      CDS       T01017                                 

Definition
(RefSeq) phytanoyl-CoA dioxygenase family protein
  KO
K17825  verruculogen synthase [EC:1.14.11.38]
Organism
afm  Aspergillus fumigatus
Pathway
afm00404  Staurosporine biosynthesis
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    AFUA_8G00230
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.38  verruculogen synthase
     AFUA_8G00230
SSDB
Motif
Pfam: PhyH
Other DBs
NCBI-GeneID: 3504528
NCBI-ProteinID: XP_747181
UniProt: Q4WAW9
LinkDB
Structure
PDB: 
6OXJ 6OXH 4Y5T 4ZON 4Y5S

Position
8
AA seq 291 aa
MTVDSKPQLQRLAADADVDRMCRLLEEDGAFILKGLLPFDVVESFNRELDVQMAIPPPKG
ERLLADKYPPHFKYVPNVATTCPTFRNTVLINPVIHAICEAYFQRTGDYWLSAAFLREIE
SGMPAQPFHRDDATHPLMHYQPLEAPPVSLSVIFPLTEFTEENGATEVILGSHRWTEVGT
PERDQAVLATMDPGDVLIVRQRVVHAGGGNRTTAGKPRRVVLAYFNSVQLTPFETYRTMP
REMVESMTVLGQRMLGWRTMKPSDPNIVGINLIDDKRLENVLQLKAADSPA
NT seq 876 nt   +upstreamnt  +downstreamnt
atgaccgtcgactccaagccacaactccagcgcctcgccgccgatgccgacgttgaccgg
atgtgcaggctcctcgaagaggacggtgcctttatcctcaagggcctgctgcccttcgac
gtcgtcgagagcttcaaccgcgagttggacgtgcaaatggccatcccacctcccaaagga
gaacggctgctggcggacaaatacccccctcacttcaaatatgtcccgaacgtcgccacc
acttgcccgacgttccgcaacaccgttctcatcaacccggtcatccacgccatctgcgag
gcctacttccagcgcacgggtgattactggctcagcgcggccttcctccgcgaaattgaa
tcgggaatgcccgcccagccgttccaccgcgacgatgccacccacccgctgatgcactac
cagcccttggaagcaccgccggtttccctcagcgtcatctttcccctgacagagttcacg
gaggagaatggtgccacagaggtcatcctcggcagtcatcggtggacagaggtcgggacg
ccggagcgcgaccaggcagttctcgcgactatggacccgggcgatgtgctcattgtacga
cagcgtgtggtgcatgcgggcggtgggaatcgcacgacggccggcaaacctcgacgggtt
gttctcgcgtacttcaatagcgtccagctgaccccattcgagacctaccggacgatgccg
cgcgagatggtcgagtcgatgactgttctcggccagaggatgctcggctggagaaccatg
aaaccgtccgatcccaacattgtgggcatcaacctgatagatgataagcggctggagaat
gtgctgcagttgaaggctgctgattcgccggcttag

DBGET integrated database retrieval system