KEGG   Aspergillus fumigatus: AFUA_8G00250
Entry
AFUA_8G00250      CDS       T01017                                 

Definition
(RefSeq) dimethylallyl tryptophan synthase
  KO
K14134  12alpha,13alpha-dihydroxyfumitremorgin C prenyltransferase [EC:2.5.1.110]
Organism
afm  Aspergillus fumigatus
Pathway
afm00404  Staurosporine biosynthesis
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    AFUA_8G00250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:afm01006]
    AFUA_8G00250
Enzymes [BR:afm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.110  12alpha,13alpha-dihydroxyfumitremorgin C prenyltransferase
     AFUA_8G00250
Prenyltransferases [BR:afm01006]
 Compound prenylation
  Indole prenyltransferase
   AFUA_8G00250
SSDB
Motif
Pfam: Trp_DMAT
Other DBs
NCBI-GeneID: 3504526
NCBI-ProteinID: XP_747179
UniProt: Q4WAX1
LinkDB
Position
8
AA seq 427 aa
MTIPTEISCPEEDAFQLLDKFSWFPSDDQRRWWEYTGPYLLKLLRDAKYPQKDQVPCLYL
LQQLLVPYLGTFPVVGQAPLPWWSNVTTYGVPFELSWNLLHNIVRIGFEPLSHLAESGVD
AFNKTAPEECVSRLACLDNTIDLARFRHFQHHLLVTPEEETWLLKEKAPLAKSGRGQQTL
AVEFQNGGISAKAYFFPGMKSLATGLSPGKLILDSIERLALPGLKEPVHHLRSTLGLQDD
GHPTDTAIAPFLLGVDLCTPERSRLKFYVTDQVVSWDRVADMWTLRGKRLEDPQCADGLA
LLRKLWDLLAIPEGYRSNIRPDFAFGTPPPEDYRPVMMANWTLSPKKKFPDPQIYLLTVG
MNDAVVMDALVAFYEVLGWTDLASTYKDKVASYFPGPDFTKTNYIHSGVSFSYRHSKPYL
SVYYSPF
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgaccataccaactgagatttcgtgccctgaagaagacgcattccagctcctcgacaag
ttctcatggtttcccagcgacgaccagcgacgttggtgggaatatactggaccctatctg
ctcaagcttctgcgtgatgctaaatatccgcagaaggatcaggttccctgcctctatctc
ctgcagcaactgctggttccatacctcggcaccttcccagtcgtgggacaagcacctctg
ccttggtggagcaatgtgaccacctatggcgttccgttcgagctcagctggaatcttctg
cataatatcgtgcggattggcttcgaaccactctcacacttggcagaatccggcgtcgat
gctttcaacaagacagcgccagaggaatgcgtctcccgcctagcgtgtcttgacaacacc
atcgatctagcgcggttcagacacttccaacaccaccttttggtgactcccgaggaggaa
acatggttgctcaaagagaaagcccccctcgccaagtctggacgaggccagcaaaccctg
gccgtggaattccagaatggtggcatcagcgccaaagcctacttcttccccggcatgaag
tcgctggcgactggactctcgccaggaaagctcattcttgactccatcgagaggctcgct
ctcccaggattgaaggaacccgtgcatcacctccgcagcaccctcggcctgcaagacgac
gggcacccgacagataccgcgattgccccgttccttctcggtgtcgacctgtgcactccc
gaacgaagtcgcctgaaattctatgtgaccgaccaggtggtttcatgggatcgggtagcg
gacatgtggactcttcgcgggaaacgtctggaagatcctcaatgtgccgatggtctggcc
ctcctgaggaaactgtgggatctcctcgcgatccctgaagggtatcggagcaacatccgg
ccggactttgcttttgggacgcctcctcccgaggactaccgtcccgttatgatggcgaac
tggaccctatctcccaagaaaaaatttccggacccccagatatacctcctgaccgttggg
atgaatgacgccgtcgtcatggacgcactcgtggcgttctacgaggttctgggttggacg
gatctggccagcacgtacaaggacaaagtggcctcatacttccccggccctgactttacg
aaaaccaattacattcactcgggggtttccttctcgtatcgccactccaagccctacctg
agtgtttattattcgcctttttga

DBGET integrated database retrieval system