KEGG   Alcaligenes faecalis JQ135: AFA_03675Help
Entry
AFA_03675         CDS       T05446                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
afq  Alcaligenes faecalis JQ135
Pathway
afq00471  D-Glutamine and D-glutamate metabolism
afq00550  Peptidoglycan biosynthesis
afq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AFA_03675
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AFA_03675
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:afq01011]
    AFA_03675
Enzymes [BR:afq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     AFA_03675
Peptidoglycan biosynthesis and degradation proteins [BR:afq01011]
 Precursor biosynthesis
  Amino acid ligase
   AFA_03675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ASR88631
LinkDB All DBs
Position
796904..798310
Genome map
AA seq 468 aa AA seqDB search
MKHRIQHIHFVGIGGSGMSGIAEVMLNLGFAISGSDIQETAVTRRLEQLGARIVIGHKAE
NVAGMGAIVTSTAIAGDNPEVLAARAARIPVVPRALMLAELMRLKRGIAVAGTHGKTTTT
SLVASLLGAADLDPTFVIGGRLNSAGANARLGQGDYIVVEADESDASFLNLLPVMAIITN
IDVDHMDTYGHDVARLKSAFIDFTHRLPFYGSAIVCNDDANVREIIPFVSRPVTTYGIDT
DAQVRAINIESRGTTMCFDVQRKGATGELPLLSVCLNLPGKHNVLNALAAIAVATELGVS
DEVIAKGLKEFTGVGRRFSMVGDFPVSQAQGGGTFTVVDDYGHHPVEMAATLAAARGAWP
DRRIVLAFQPHRYTRTRDCFEDFVQVLSQADAVLLGEVYPAGEAPLVAADGRALSRAVRV
LGKVEPIFVAEISDMAQAVLDFVRDGDVVLVMGAGSISRIPAQLGEMA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaccgcattcaacatattcattttgtagggattggcggctcgggcatgagcggc
attgccgaagtcatgctgaacctgggttttgccatcagtggttcggatatccaggaaacg
gcggtaactcgtcgcctggagcagctcggtgcccgtattgttatcggtcacaaggctgaa
aacgtcgctggtatgggcgctattgtcacttccaccgccattgcaggcgacaaccccgaa
gttctggctgcgcgtgcagcccgcatccctgtggtgccacgtgccctgatgctggccgag
ctgatgcgcttaaagcgcggtatcgccgtggccggcacgcacggcaagaccaccaccacc
agcttggtggccagtctgttgggggctgctgatctggacccgacctttgtgatcggtggt
cgcctgaattcggcgggtgccaatgctcgtttggggcagggtgattacatcgtggtggaa
gccgacgagtctgacgcctcctttttgaatctgttgccggtgatggccatcatcaccaat
atcgatgtagaccatatggacacctatggtcatgacgttgcccgactgaaaagtgcgttc
attgatttcacgcatcgcctgccgttttacggcagtgccattgtgtgcaatgacgatgcg
aatgtgcgcgaaatcattccttttgtatcgcgccctgtcaccacttacggtattgatacc
gatgctcaggtccgcgcgatcaacatcgaaagccgtggcaccaccatgtgttttgatgtg
cagcgcaaaggggcaacaggtgagcttcctttgctgtccgtgtgtctgaatctgcccgga
aaacacaatgtactcaatgccttggctgctattgcagtagccactgaattgggtgtcagt
gacgaggtcattgccaaaggcctgaaagagttcaccggtgtgggccgtcgcttctccatg
gtaggggacttcccagtttcccaggcgcaaggcggcgggacgtttaccgttgttgacgat
tatggtcaccatcctgtcgaaatggctgctaccttggcggccgcacggggtgcttggcct
gatcgccgcattgtgttggcgttccagccacaccgctatacgcgtacccgtgattgcttt
gaagatttcgtgcaggtacttagccaggctgacgctgtcctcctgggtgaggtctatccc
gcaggcgaggcgcccctggtggccgccgatggtcgtgccttgagtcgtgccgtgcgcgta
ctgggcaaggtcgaacctatttttgtggccgaaatcagcgatatggcacaagccgttctg
gattttgtccgtgatggtgatgtggtgttggtaatgggtgcaggatccatcagccggatt
cctgctcaattgggagaaatggcatga

DBGET integrated database retrieval system