KEGG   Alcaligenes faecalis JQ135: AFA_05720Help
Entry
AFA_05720         CDS       T05446                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
afq  Alcaligenes faecalis JQ135
Pathway
afq00564  Glycerophospholipid metabolism
afq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AFA_05720
Enzymes [BR:afq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AFA_05720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 Thi4 Lycopene_cycl NAD_binding_8 HI0933_like Pyr_redox_3 FAD_binding_3 Pyr_redox XAF1_C GIDA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ASR88982
LinkDB All DBs
Position
1260046..1261644
Genome map
AA seq 532 aa AA seqDB search
MTTLSSPLLTDRAQMMGALARTTQADMVVVGGGATGLGVALDAALRGLSVVVLEARDFAK
GTSSRATKLVHGGVRYLAQGNVSLVREALRERMHLLSNAPHLAQRLPFVMPSYKCWETPF
YGVGLMAYDGLAGREGLGHTQFLSASKIRQLLPGARQSGLKGGVKYWDGQFDDARLALAL
ARTAALNGALLVNYCPVVEVMHRDGKVSGVRCQDGESGQAYTIQSHCVVNATGVWVDQVR
ELDAREAGRQLRPMVSPSQGVHLVVDQTFLPGEHALLVPRTKDGRVLFAVPWLGKLILGT
TDTPRDDVPLEPRPMAQEVDFILKESANYLQKAPTARDVRSIWVGLRPLVRPAAESAAGK
TQSISREHSITVSTNGLLTVTGGKWTTYRAMAEDVLERCQQSGLLGPLPACRTQEQRLVG
ASYVGDRRSLGRTAGLDAYGSEADWVQALPGADQELAPGLSVAMVRFACRFEYARTVEDM
LARRSRLLFLDARLAQSLAPAVAAIMQEETGRSPELDAFLALAEQYATVPTC
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgactacattaagttcccccttattaaccgatagagcccagatgatgggcgccttggcg
cgcaccactcaggcggatatggtcgtggtggggggcggggcaaccggcctgggtgtggcc
ctggacgcggccctgcgcggcttgagtgtggtggtgttggaagcccgggattttgccaag
ggcacgtcctcgcgggccaccaagctggtacacggcggggtgcgttatctggctcagggc
aacgtcagcttggtacgcgaggccttgcgcgaacgcatgcatttgctcagtaatgcgccg
catctggcccagcgcctgccttttgtcatgcccagctacaaatgctgggaaaccccgttt
tatggggtcggcttgatggcgtacgacggtttggcagggcgggaagggctgggccatacc
cagtttctgagcgcttctaaaattcggcaactgttgccgggtgcccgtcaaagtggcttg
aaaggcggtgtgaaatattgggatggtcagtttgacgatgcgcgtctggctttggccctg
gcccgtacggcggccttgaatggtgccttgctggtcaattactgcccggttgtggaagtg
atgcaccgcgatggcaaggtgtctggggtgcgttgccaggacggagaaagtggtcaagcc
tatacgatccagagtcactgcgtggtcaatgccacgggggtgtgggtggatcaggttcga
gaactggatgcgcgggaagccgggcgtcaattgcggcctatggtctcgcccagtcagggg
gtgcacttggtggtcgatcagacatttctgcccggtgaacacgccttgctggtgccgcgt
accaaggatggccgggtactgtttgccgtgccttggctgggcaagctgattctgggaacc
acggataccccacgggatgatgttcctttggagccgcgccctatggcccaggaagtggat
ttcattctgaaagaatcggcgaattatctgcaaaaagccccgactgcgcgggacgtgcgc
agtatctgggtaggcttgcggcccttggtgcgcccggctgccgagtcggctgcggggaaa
acgcaatcgatcagccgggaacacagtattacggtgagcaccaatggtttattgacggta
acgggtggcaagtggacaacgtaccgagccatggctgaggatgtgctggaacgttgccag
cagtccggtttgctggggcctttgcctgcctgccggactcaggagcaacgcttggtaggt
gcttcttatgtaggcgatcggcgctctttggggcgtaccgctggcctggatgcttatggc
agtgaggctgattgggtgcaggccttgcccggagccgatcaagagctggctccaggcctg
agcgtggccatggtgcgctttgcctgccgctttgagtatgcccgtaccgtggaagacatg
ctggcccgtcgttctcggcttttgttcctggatgcgcgcctggcgcaatcacttgccccg
gctgtggcggcgattatgcaagaggaaacggggcgttcgcccgaactggatgcttttctg
gcgttggccgagcaatacgctaccgtgccgacgtgctag

DBGET integrated database retrieval system