KEGG   Alcaligenes faecalis JQ135: AFA_08520Help
Entry
AFA_08520         CDS       T05446                                 

Definition
(GenBank) phenol hydroxylase
  KO
K16243  phenol/toluene 2-monooxygenase (NADH) P1/A1 [EC:1.14.13.244 1.14.13.243]
Organism
afq  Alcaligenes faecalis JQ135
Pathway
afq00361  Chlorocyclohexane and chlorobenzene degradation
afq00362  Benzoate degradation
afq00623  Toluene degradation
afq01100  Metabolic pathways
afq01120  Microbial metabolism in diverse environments
afq01220  Degradation of aromatic compounds
Module
afq_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:afq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AFA_08520
   00361 Chlorocyclohexane and chlorobenzene degradation
    AFA_08520
   00623 Toluene degradation
    AFA_08520
Enzymes [BR:afq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     AFA_08520
    1.14.13.244  phenol 2-monooxygenase (NADH)
     AFA_08520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phenol_Hydrox
Motif
Other DBs
NCBI-ProteinID: ASR89482
LinkDB All DBs
Position
1822236..1823243
Genome map
AA seq 335 aa AA seqDB search
MTLEIKTASLQPVRQTFANVARRFGEKPATRYQEATYDAQATANFHYRPLWMPDKTLNDP
THTAIQMKDWYVFRDPRQFYYGAYVQNRARMQEAAETNYGFFEKRDLAQYLSEEVKAKVT
RLLLPLRHIEQTANLNFMSGSAYGYGTTITQACLYAGMDALGMAQYVSRIGLLIDGNSAD
SLSQAKEAWMQDAAWQGLRALCEKTLVQKDWFELLLVQSLLINTVVHQVVYQGLVADLAK
EGGRDLDMLLEFMLDCHKDLSNWSDSVFKIAVAESEQNKQQLQNWLDQWLPQVQAAFMPY
IQAAFADQADQVWAQVQETIAKRVTKAGLSLGGEA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgacattagaaattaaaacggccagtttgcagcccgtgcggcaaaccttcgccaacgtg
gctcgccgctttggtgaaaagccggctacccgctaccaggaagcgacatacgatgcccag
gcgacggccaactttcattaccggcccctgtggatgccggacaagaccctgaatgacccc
acgcataccgccatccagatgaaggattggtatgtgttccgtgacccccgtcagttctac
tacggtgcttacgtgcaaaaccgtgcccgcatgcaggaagcggctgaaaccaattacggc
ttttttgaaaagcgtgatctggcccagtacctgagcgaggaggtcaaagccaaggtcacc
cgtttgctgctgcctttgcgccacatcgagcaaaccgccaatctgaacttcatgtccggc
tcggcctatgggtatggcaccactattacccaagcctgtctctatgccgggatggacgcg
ctgggtatggcgcaatacgtctcccgtattggcctgctgattgatggcaatagtgccgat
tccctgagccaagccaaagaggcctggatgcaggatgcggcctggcaaggtctgcgtgcc
ttgtgcgaaaaaacgctggttcagaaagactggtttgaactgctgctggtgcagtccttg
ctgatcaacaccgtggtgcatcaagtggtgtatcaggggctggtggcggatctggccaag
gaaggcggccgcgatctggatatgctgctggagttcatgctggattgtcataaagacctg
tccaactggagcgatagtgtcttcaagattgccgttgctgaaagcgagcaaaacaagcag
caattgcaaaactggctggatcagtggctgccgcaagtgcaagccgccttcatgccctac
atccaggctgcctttgccgaccaggctgatcaagtctgggcacaagtgcaggaaaccatt
gccaaacgcgtcacaaaagcaggcctgagcctggggggagaggcctga

DBGET integrated database retrieval system