KEGG   Alcaligenes faecalis JQ135: AFA_15900Help
Entry
AFA_15900         CDS       T05446                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
afq  Alcaligenes faecalis JQ135
Pathway
afq00970  Aminoacyl-tRNA biosynthesis
afq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AFA_15900
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:afq03029]
    AFA_15900
Enzymes [BR:afq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AFA_15900
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AFA_15900
Mitochondrial biogenesis [BR:afq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AFA_15900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: ASR90812
LinkDB All DBs
Position
3460857..3462314
Genome map
AA seq 485 aa AA seqDB search
MEWEIVIGLETHTQLSTESKIFSSSSTRFGALPNTQANEVDMALPGALPVFNRGAAERAI
RLGLAVGGHIAPRSVFERKNYFYPDLPKNYQISQMEIPVVSGGTVSFMLDGEEKTINLTR
AHLEEDAGKSLHENFRGPYGESSTGIDLNRAGTPLLEIVSEPEMRSAAEAVGYARALHSL
VVWLGICDGNMQEGSFRVDANVSVRPKGQKEFGTRCELKNINSFRFLERAIQYEARRQIE
LIEDGGKVTQETRLYDSDRDETRSMRSKEDAHDYRYFPDPDLPPLFISEEWIEQVRQDMP
ELPAQKQARFEQEFELSRYDASQLTVDRATSDFFEAILQAGSSANAKLAANWVLGELSAA
LNREEISIEQSKVSPAQLAQLIARIADGTISNKIARDVFAAQWDGELNGDVDAIIESRGL
KQINDVGAIAAMVDEVLAANPSIVEQHRAGKPKAFNALVGQVMKAAKGKANPQQINEMLK
QKLDA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggaatgggaaattgtgatcgggctggaaacccatacccagctctcgaccgaatccaaa
attttctccagcagcagcacccgctttggggctttgcccaacacgcaagccaacgaagtc
gatatggccctgcctggcgctctgcccgtctttaaccgtggcgcagccgaacgggcgatt
cgcctaggcctggccgtaggtggccacattgcgccgcgctccgtgttcgagcgcaaaaac
tacttctaccctgaccttcccaagaactaccagatcagccagatggaaattcccgtcgtc
agcggcggcacggtcagcttcatgctggacggcgaagaaaagaccatcaatctgactcgt
gctcacttggaagaagatgccggtaaatccctgcacgagaacttccgtggtccttacggc
gagtccagcaccgggatcgacttgaaccgcgcaggcactccgctgctggaaatcgtgtcc
gaacctgaaatgcgctcggctgctgaagctgtgggctatgcccgcgccttgcacagcctg
gttgtctggctgggcatttgcgacggcaatatgcaggaaggctccttccgcgtggacgcc
aacgtatcggtacgccccaaaggtcagaaagaatttggcacccgttgcgaactgaagaac
atcaactcctttcgcttcctggaacgtgccattcaatacgaagcacgtcgccagatcgag
ttgatcgaagacggtggcaaggtcactcaggaaacccgcctgtacgactcggatcgcgat
gagacccgcagcatgcgcagcaaggaagatgcacacgattaccgctacttccccgaccct
gacctgccacctctgtttatcagtgaagaatggatcgagcaggttcgtcaggacatgcct
gaactgcccgcccagaaacaggctcgcttcgagcaagagtttgaactgagccgttacgac
gcctcgcaactgacggtagaccgtgccacttccgacttctttgaggccatcttgcaagcg
ggttccagcgccaatgcaaaactggctgccaactgggtgctgggcgaactgtcggctgcc
ttgaaccgtgaagaaatcagcatcgaacagtccaaagtcagcccggcacaactggctcag
ctgattgcccgtattgctgacggcaccatctccaacaagattgcccgcgatgtctttgcg
gcgcagtgggatggcgagctcaatggtgacgtggacgccatcatcgaatcccgtggcttg
aagcagatcaacgatgtgggcgcgattgctgccatggtggacgaagtactggccgccaac
cccagcatcgtcgaacagcaccgtgccggtaaacctaaagcgttcaacgccctggtcggc
caggtgatgaaggcggccaagggcaaagccaatccgcagcaaatcaatgaaatgctcaag
caaaagctggacgcttaa

DBGET integrated database retrieval system