KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_0203Help
Entry
AFE_0203          CDS       T00810                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00473  D-Alanine metabolism
afr00550  Peptidoglycan biosynthesis
afr01100  Metabolic pathways
afr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:afr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AFE_0203 (ddlB)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AFE_0203 (ddlB)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AFE_0203 (ddlB)
Enzymes [BR:afr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AFE_0203 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:afr01011]
 Precursor biosynthesis
  Amino acid ligase
   AFE_0203 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 TTL ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ACK78050
UniProt: B7J3U9
LinkDB All DBs
Position
complement(179117..180043)
Genome map
AA seq 308 aa AA seqDB search
MSDLARIAVLYGGPSGEREVSLDSGHAVLQTLQGLGMDAVGVDIQPAILQQQMAESGAQI
AFNVCHGAVGEDGLLQACLETLDMPYTGSGVLASALAMDKWRCKQLWRAAGLPVTDGILL
HRGSHTPDLGARFGWPLYIKPNHGGSSLGVSKVGGPAELDAALQCAFAIEDEVLCEGAVI
GHEVTVGILDGQALPPIVIETPRAFYDYTAKYLADDTRYLLPSGLGAPLEQQLQALALRA
FAELGCRDWGRVDFMIGGDGRPHLLEVNSVPGMTSHSLIPMAAKATGMGFPELCATILRT
AQRRVKHG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatttagcccgcatcgccgtactttacggaggcccctccggagaacgcgaagtc
tctctcgacagcggtcacgccgtgttgcaaaccttgcaggggctgggcatggatgccgtc
ggcgtcgacatccagccggccatcctccagcagcaaatggccgaaagcggagcacagatc
gccttcaacgtctgccatggcgcggtaggcgaagacggtctgttgcaggcctgcctggag
actctggatatgccctacaccggcagcggtgtcctcgcctccgctctcgccatggataaa
tggcgctgcaagcagctctggcgagccgccggtttaccggtgaccgacggcatcctgctg
catcgcggcagccatacgcccgacctcggcgcccgcttcggctggcccctgtacatcaag
ccgaaccacggtggctccagcctcggggtcagcaaagtcggcggcccggcggaattggat
gcggccttgcagtgcgccttcgccatcgaggatgaagtcctctgcgagggtgccgtcatc
ggtcacgaagtcaccgtcggcatcctcgatggccaggcgctgccgccgatcgtcatcgaa
acgccccgggccttctatgactacaccgccaagtatctcgccgacgatacccgttatctc
ctgccctccggcctcggcgctccgctggagcagcagttgcaggcacttgcgctccgagcc
tttgccgagctcggctgccgcgactgggggcgggtcgacttcatgatcggcggcgacggt
cgaccccatctgctggaagtcaacagtgtgcccggcatgaccagccacagcctgattccc
atggccgccaaagccaccggcatgggcttcccggaattatgcgccaccatactgcgcacc
gcgcagaggagagtgaaacatggttag

DBGET integrated database retrieval system