KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_0734Help
Entry
AFE_0734          CDS       T00810                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
afr01100  Metabolic pathways
afr01110  Biosynthesis of secondary metabolites
afr01130  Biosynthesis of antibiotics
afr01230  Biosynthesis of amino acids
Module
afr_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:afr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AFE_0734 (aroK)
Enzymes [BR:afr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     AFE_0734 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin Cytidylate_kin2 dNK AAA_5 AAA_16 CoaE AAA_22 AAA ABC_tran AAA_29 AAA_28 TsaE PduV-EutP
Motif
Other DBs
NCBI-ProteinID: ACK79787
UniProt: B7J630
LinkDB All DBs
Position
complement(663307..663846)
Genome map
AA seq 179 aa AA seqDB search
MTGSIILIGPMGSGKSTIGRLLAARLRLPYVDSDALIVHHTGVDIPTIFEIEGESGFRER
ERKIIADLSTWSEPMVLATGGGAILDPANRHHLRQMGQVIHLDISVDEQLRRIRHDRNRP
LLQNTDLDCRLKTLAEQRNTLYRETAHWRVVGDGLRSDQVLRRILRHLQQRAGHPPVRG
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcagcatcatcctcatcgggcccatgggatcgggcaaatcgaccatcgggcgg
cttctggccgcccgcttgcgtcttccttatgtggatagcgacgcgctcatcgtccatcat
acgggggtggatattcccactatttttgagatcgagggggaatcgggtttccgcgaacgg
gaacgcaaaatcatcgccgacctctccacctggagcgaaccgatggtactcgccaccggc
ggcggcgccatactcgacccggccaatcgacatcatctgcggcagatgggccaggtcatt
catctggatatcagcgtcgacgagcaactcagacgtattcgccatgaccgcaaccgccca
ctgctgcaaaatacggaccttgattgccgtctgaaaacactggcggagcagcgtaatacc
ctgtaccgggagactgcccactggcgggtggtgggggacggtctgcgctcggatcaggtt
ctgcgccggatactgcgccacctccagcagcgggcagggcacccccccgtccgggggtag

DBGET integrated database retrieval system