KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_1898Help
Entry
AFE_1898          CDS       T00810                                 

Gene name
sod
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Brite
Enzymes [BR:afr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AFE_1898 (sod)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACK77830
UniProt: B7JC00
LinkDB All DBs
Position
complement(1657813..1658430)
Genome map
AA seq 205 aa AA seqDB search
MSEYSVREELKPSGLDGISDAQITDHWGLYVGYVNQSNALHKELAEMRAAGKTSSLAYAD
RRRRFGFEYNGMVLHEYYFAQLKPGSSIDQAPGFKAAVTEQFGSAEVWHEDLVSAAKSRS
VGWAIAYYDGTTGQINNHFVQLHEDGNVGGFVPLVIVDVFEHAYMVDWKALGRADYLAAV
HKNMNWGVVEARFQAARSGQIFKRF
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaatatagcgtgcgcgaagaattgaagcccagcggcctggatggcatctccgat
gcccaaattacggatcactggggcctttatgtaggttatgtcaaccagagcaatgcgttg
cacaaagagcttgcagaaatgcgggcggcgggtaaaaccagttccctcgcctatgcagat
cgccgcaggcgctttggctttgagtataacggcatggttttacatgagtattattttgcg
caactgaagccgggcagcagtatcgatcaggcacccggcttcaaggcagcggtcacggaa
cagtttggcagcgctgaggtatggcacgaagatctggtgtctgcggccaagagccggagc
gtgggttgggccatcgcttattatgatggtactaccggtcagatcaacaaccacttcgtt
caactccacgaagacggtaacgtgggtggtttcgtgccgctggttatcgtcgatgtcttc
gagcacgcctatatggtggactggaaggcacttggccgcgcggattacctggcagccgtt
cacaaaaacatgaactggggcgtggtggaagcgcgcttccaggcagcccgaagtggtcag
attttcaagcgcttctga

DBGET integrated database retrieval system