KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_2594Help
Entry
AFE_2594          CDS       T00810                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
afr00480  Glutathione metabolism
afr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AFE_2594 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:afr02000]
    AFE_2594 (gst)
Enzymes [BR:afr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AFE_2594 (gst)
Transporters [BR:afr02000]
 Other Transporters
  Pores ion channels [TC:1]
   AFE_2594 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N_2 GST_N GST_N_3 GST_C_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: ACK78121
UniProt: B7J7R1
LinkDB All DBs
Position
complement(2303356..2303970)
Genome map
AA seq 204 aa AA seqDB search
MKLYYSPGACSLSPHIILNEGGFSFDRERVDLASKKTETGADYAAINPDGYVPALLLDDG
QVLTEGPAIIQYLADRVPEKKLAPPLGTLERYRLMQWLNFISTELHKGFSPLFHPQAPKE
WKTVVAAQLGRRLSTVSRQLEGKDWLLGEGFTVADAYLFTVLGWGRHVGIDVEQWPVLQA
YQGRVSTRPAVQSALKAEGLLQDT
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgtattacagccccggtgcgtgttccctctctccccatatcatcctcaacgaa
ggcgggttcagcttcgacagggaaagggtggacctcgccagcaagaaaacggaaaccggt
gccgactatgccgccatcaaccccgacggctacgtgcccgccctgctgctcgacgacggg
caggtgctcaccgaggggccggccatcattcagtacctggccgaccgcgtgcccgaaaag
aagctcgccccgcccttgggcacgctggagcgctaccggctcatgcagtggctcaatttc
atctctacggaactgcacaagggtttttctcccttattccatccgcaggcgcccaaggaa
tggaagacggtggtcgctgcccaactcgggcggcgcctgagcacggtcagccggcagctg
gagggcaaggattggttgctgggcgagggcttcacggtggccgacgcctatctctttacg
gtattgggctggggacggcatgtgggcattgacgtggagcaatggccggtgctccaggcg
tatcaggggcgggtatccacgcggcctgcggtgcaatcggccctgaaggcggaaggtctg
ctccaggatacctga

DBGET integrated database retrieval system