KEGG   Actinoplanes friuliensis: AFR_05140Help
Entry
AFR_05140         CDS       T02892                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
afs  Actinoplanes friuliensis
Pathway
afs00020  Citrate cycle (TCA cycle)
afs00480  Glutathione metabolism
afs01100  Metabolic pathways
afs01110  Biosynthesis of secondary metabolites
afs01120  Microbial metabolism in diverse environments
afs01130  Biosynthesis of antibiotics
afs01200  Carbon metabolism
afs01210  2-Oxocarboxylic acid metabolism
afs01230  Biosynthesis of amino acids
Module
afs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
afs_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:afs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AFR_05140
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AFR_05140
Enzymes [BR:afs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AFR_05140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: AGZ39317
UniProt: U5VR80
LinkDB All DBs
Position
1119809..1121023
Genome map
AA seq 404 aa AA seqDB search
MAKIKVNNPVVELDGDEMTRIIWKQIREQLVLPYLDVNLEYYDLSIQYRDETDDQVTIDA
ANAIKRHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVVFREPIIMSNVPRL
VPGWTKPIIIGRHAHGDQYKATDFVTPGPGKLTVTFTPEDGSAPMEFHVADYPGGGVAMA
MYNYDDSIRDFARASFRYGLARNYPVYLSTKNTILKAYDGRFKDLFAEIFETEFAEKFKE
AGITYEHRLIDDMVAAAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDGK
TVEAEAAHGTVTRHYRQWQKGEKTSTNPIASIFAWTGGLKHRGVLDGTPAVTEFAETVEK
VCVETVEGGQMTKDLALLISRDAPWLTTDEFMNALDENLARKLA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcaaggtcaacaacccggtcgtggagctcgacggcgacgagatgacccgg
atcatctggaagcagatccgcgagcagctggtcctgccgtatctcgacgtcaatctcgag
tactacgacctgtcgatccagtaccgcgacgagaccgatgaccaggtgaccatcgacgct
gccaacgccatcaagcggcacggcgtcggcgtcaagtgcgcgacgatcaccccggacgag
gctcgcgtcgaggagttcggcctgaagaagatgtggcggtcgccgaacggcacgatccgc
aacatcctcggtggtgtggtcttccgtgagccgatcatcatgtcgaacgtcccccggctc
gtaccgggctggaccaagccgatcatcatcggccggcacgcgcacggtgaccagtacaag
gcgaccgacttcgtgacgccggggccgggcaagctcaccgtcacgttcacgcccgaggac
ggctccgcgccgatggagttccacgtcgcggactacccgggtggcggcgtcgcgatggcg
atgtacaactacgacgactcgatccgcgacttcgcgcgcgcctcgttccggtacggcctg
gcccgcaactacccggtctacctgtcgacgaagaacacgattctcaaggcgtacgacggc
cggttcaaggatctgttcgccgagatcttcgagaccgagttcgcggagaagttcaaggaa
gccggcatcacctacgagcaccggctgatcgacgacatggtcgccgccgcgatgaagtgg
gagggcggctacgtctgggcctgcaagaactacgacggtgacgtgcagtccgacaccgtc
gcgcagggcttcggctcgctcggcctgatgacctcggtgctgatgacgccggacggcaag
accgtcgaggcggaggccgcgcacggcacggtcacccggcactaccggcagtggcagaag
ggtgagaagacctcgacgaacccgatcgcgtcgatcttcgcgtggaccggtggcctcaag
caccgcggtgtgctcgacggcaccccggcggtcacggagttcgccgagacggtcgagaag
gtctgcgtcgagacggtcgagggcggtcagatgaccaaggacctcgcgctgctcatctcg
cgggacgcaccctggctgaccacggacgagttcatgaacgcgctggacgagaacctggcg
cgcaagctcgcctga

DBGET integrated database retrieval system