KEGG   Actinoplanes friuliensis: AFR_05255Help
Entry
AFR_05255         CDS       T02892                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
afs  Actinoplanes friuliensis
Pathway
afs00620  Pyruvate metabolism
afs00680  Methane metabolism
afs01100  Metabolic pathways
afs01120  Microbial metabolism in diverse environments
afs01200  Carbon metabolism
Module
afs_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:afs00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AFR_05255
  Energy metabolism
   00680 Methane metabolism
    AFR_05255
Enzymes [BR:afs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AFR_05255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase Phage_TAC_6
Motif
Other DBs
NCBI-ProteinID: AGZ39340
UniProt: U5VUD6
LinkDB All DBs
Position
complement(1145238..1148033)
Genome map
AA seq 931 aa AA seqDB search
MTDQHGQLDPDGPDAALRADIRRIGTLLGQTLARQEGKPLLDLVEEVRALVRADAPAAAE
RLAAMDVTTGTKLARAFSTYFHLANITEQVHRSRDLQRRRARDGGWLDQAAKRIAEQGVP
ADEIAAAARRLAVRPVFTAHPTEAARRSILSKLRQLADSLDGEASAAILYGASDTTASTR
RFAELIDLLWQTDELRLDRPDPTDEARNAVYYLKDLYAEAAPQVLDDLAETLRQLGVETA
PTSRPLTFGTWIGGDRDGNPFVTPAVTRDVLMIQHEHGIQATEAAMDALIDELSVSRRLR
GVSLDLSASLAKDLDLLPEVAERFRRTNAEEPYRLKVRCIKAKLANTRERLRRGTAHVAG
RDYLGSDELIADLELMRASLARNSGQLTAVGTVASAIRTVSSFGLQLATLDVREHAEKHH
EVLAQMYTQVGEVDDYLSLGRPERTKLLATELTGRRPLSSADTPLTDSARKTFDVFNTIR
ESQDRFGAEVIESYIISMTLGVDDVLAAAVLARESGLIDIQNGRARIGIVPLLETPAELD
AGGELLDEMLSLPAYREIVKARGDLQEVMLGYSDSNKEAGITTSQWSIHKAQRALRDVAA
RHGVRLRLFHGRGGTVGRGGGPTHEAILAQPYGTLDGAIKVTEQGEVISDKYTLPALARE
NLELTVAAVLQATLLHTTPSVDLESLARWDGAMDTASGAAFGAYRALVENPDLPAYFWAA
TPTELLGALNIGSRPAKRPNTDAGLGGLRAIPWVFGWTQTRQIVPGWFGVGTGLEAVRAA
GQADVLQEMYANWQFFRTFISNVEMMLAKTDLNIARRYVETLVPADLKPIFTTIEQEYAK
TVEQILAITGREDLLSSQPELSRTLGVRDTYLEPLHHLQVALLRQYRELNDEDRSLPTAP
GTRRATSDSTALERALLTTVNGIAAGMRNTG
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
gtgacagaccagcacggccagctcgaccccgacggccccgacgcggcgctgcgcgccgac
atccggcgcatcggcacgttgctcggccagaccctcgcccggcaggagggcaagcccctg
ctcgacctggtcgaggaggtccgagcgctggtccgggccgacgccccggccgcggccgag
cgcctcgccgccatggacgtcaccaccggcaccaagctggcccgggcgttctccacctac
ttccacctggcgaacatcaccgagcaggtgcaccgctcccgcgacctgcagcgccgccgc
gcccgtgacggcggctggctcgaccaggccgccaagcggatcgccgagcagggtgtgccc
gccgacgagatcgccgccgccgcccgccgcctcgcggtccgcccggtcttcaccgcccac
ccgaccgaggcggcccgccgctcgatcctgtccaagctgcggcagctcgccgactccctg
gacggcgaggccagcgccgcgatcctgtacggcgccagcgacaccaccgcctcgacccgg
cgcttcgcggagctgatcgacctgctctggcagaccgacgagctgcgcctggaccgcccg
gacccgaccgacgaggcccgcaacgccgtctactacctcaaggacctctacgccgaggcc
gcgccgcaggtgctcgacgacctcgccgagacgctgcgccagctcggcgtggagacggca
ccgacgtcgcgcccgctgaccttcggcacctggatcggcggcgaccgcgacggcaacccg
ttcgtcacgccggccgtcacccgcgacgtgctgatgatccagcacgagcacggcatccag
gccaccgaggccgccatggacgccctgatcgacgagctgtcggtgtcccggcggctgcgc
ggggtgtccctggacctctccgccagcctcgccaaggacctcgacctcctgcccgaggtc
gcggagcgcttccggcgcaccaacgccgaggagccgtaccgcctgaaggtccggtgcatc
aaggcgaagctggccaacacccgcgaacgcctgcgccgcggcaccgcacacgtcgccggc
cgggactacctcggcagcgacgagctcatcgccgacctcgagctcatgcgcgcgtccctg
gcccgcaactccggccagctcaccgcggtcggcacggtcgcgtcggccatccgtacggtg
tcgagcttcggcctccagctggcgacgctcgacgtccgtgagcacgcggagaagcaccac
gaggtgctcgcccagatgtacacgcaggtcggcgaggtcgacgactacctgtcgctgggc
cgccccgagcgcaccaagctgctcgccaccgagctcaccggacgccggccgctgtccagc
gccgacaccccgctcaccgactcggcgcgcaagacgttcgacgtgttcaacaccatccgc
gagtcgcaggaccggttcggcgcggaggtcatcgagtcgtacatcatctcgatgaccctc
ggcgtcgacgacgtgctcgccgcggcggtcctcgcccgcgagtccggcctgatcgacatc
cagaacggccgggcccggatcggcatcgtcccactcctggagaccccggccgagctggac
gccggtggcgagctgctcgacgagatgctgtcgctccccgcgtacagggagatcgtgaag
gctcggggtgacctgcaggaggtcatgctcggctattccgacagcaacaaggaagccggc
atcaccaccagccagtggtcgatccacaaggcccagcgcgccctgcgtgacgtggcggcc
cggcacggcgtccggctgcggctcttccacggccgcggtggcacggtcggccgtggtggc
ggccccacgcacgaggcgatcctggcgcagccgtacggcaccctcgacggcgcgatcaag
gtgaccgagcagggtgaggtcatctccgacaagtacacgctgcccgcgctggcccgcgaa
aacctcgagctgaccgtggccgcggtgctgcaggcgaccctgctgcacaccacaccgtcg
gtcgacctggagtcgctggcccgctgggacggcgcgatggacacggcgtccggtgcggcg
ttcggcgcctaccgcgctctggtcgaaaatccggacctgcccgcgtacttctgggcggcg
accccgaccgagctgctgggcgcgctgaacatcggctcccggcccgcgaagcggccgaac
accgacgccggtctcggcggcctccgggcaatcccgtgggtcttcggctggactcagacc
cggcagatcgtgccgggctggttcggggtcggcacgggcctggaagcggtccgcgcggcc
ggccaggccgacgtcctccaggagatgtacgccaactggcagttcttccgcaccttcatc
tccaacgtcgagatgatgctggcgaagaccgacctcaacatcgcccgccgctacgtcgag
accctggtcccggccgacctcaagccgatcttcaccacgatcgagcaggagtacgcaaag
acggtcgagcagatcctggccatcaccggccgcgaggacctgctgtcgagccagccggag
ctgtcgcgcacgctgggcgtccgcgacacctacctggagccgctgcaccacctgcaggtg
gcgctgctccgccagtaccgcgagctcaacgacgaggaccgctccctgccgacggcgccg
ggcacccgccgggccacctcggactcgacggccctcgaacgcgccctgctcaccaccgtg
aacggcatcgccgccggcatgcgcaacaccggctga

DBGET integrated database retrieval system