KEGG   Actinoplanes friuliensis: AFR_11495
Entry
AFR_11495         CDS       T02892                                 

Definition
(GenBank) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
afs  Actinoplanes friuliensis
Pathway
afs00052  Galactose metabolism
afs00500  Starch and sucrose metabolism
afs01100  Metabolic pathways
afs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AFR_11495
   00500 Starch and sucrose metabolism
    AFR_11495
Enzymes [BR:afs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     AFR_11495
SSDB
Motif
Pfam: Alpha-amylase DUF3459
Other DBs
NCBI-ProteinID: AGZ40588
UniProt: U5VUF8
LinkDB
Position
2486554..2488239
AA seq 561 aa
MTDQLTVPSAAPSPAAEPSPWWRDAVIYQIYPRSFADSDGDGIGDLPGIRSRLPYLRDLG
VDAVWLSPFYASPQADAGYDVADYRTVDPMFGTLADAAALITDAHGLGLRVIVDLVPNHS
SDQHEWFRRALAEGPGSPLRDRYHFRAGQGPDGSLPPNDWRSIFGGPAWTRTTNADGSPG
QWYLHLFAPEQPDFNWDHPAVADEFRTILRFWLDLGVDGFRIDVAHGLVKAEGLPDVGAT
TEWHLLDVGVSPCFDRDGVHDIYRSWRRILDEYPGERIAVAEAWAPSLDRVANYVRPDEL
HQAFNFSYLGTAWEAGAQRQVIDDSLATLRTVGAPATWTLSNHDVVRHTNRLLQTDAGDV
AGRRPTAVDPVAGLRRARAATLLLLALPGSAYLFQGEELGLPEVVDLPPEVRQDPAFHRA
SGQDGYRDGCRVPIPWEGDRAPYGFGPPDGPSWLPQPASWAALSVAAQQGDPGSTLELYR
AALALRRADPALGAADNLSWRDAPDGLLVFDRAPHFRCTVNMTAAPVRLPLPGRALLTSG
PVDLSGTEVEIPADTTIWWAV
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgaccgatcaattgacggtgccctcggcggcgccctctccggcggccgagcccagcccc
tggtggcgggacgcggtcatctaccagatctatccgcgcagcttcgccgactccgacggc
gacggcatcggcgacctgccgggcatccgcagccgcctgccctatctgcgtgacctgggc
gtcgacgccgtctggctgtcgccgttctacgcctcaccgcaggccgacgccggttacgac
gtcgccgactaccgcacggtcgacccgatgttcggcaccctcgccgacgccgccgcgctg
atcaccgacgcccacgggctcggcctgcgggtgatcgtcgacctggtccccaaccactcc
tcggaccagcacgaatggttccggcgcgcgctggccgaggggccgggctcgccgttgcgg
gaccgctaccacttccgcgccggtcagggtccggacggcagcctcccgcccaacgactgg
cggtccatcttcggcggcccggcctggacccgcaccacgaacgccgacggcagccctggc
cagtggtacctgcacctgttcgcccccgagcaacccgacttcaactgggatcacccggcc
gtggccgacgagttccgcacgattctgcgcttctggctcgacctcggtgtcgacggcttc
cggatcgacgtcgcccacggactggtcaaggccgaaggactgccggacgtcggcgccacc
accgaatggcacctgctcgacgtcggcgtcagcccgtgtttcgaccgcgacggcgttcac
gacatctaccgcagctggcggcgcatcctcgacgaatacccgggggagcgcatcgccgtc
gccgaggcctgggcgcccagcctcgaccgcgtggccaactacgtgcgccccgacgagctg
caccaggccttcaacttcagctacctcggtacggcgtgggaggcgggcgcccagcgtcag
gtcatcgacgactccctcgccacactgcgtacggtaggtgccccggcgacctggacgttg
tccaaccacgacgtcgtgcgccacaccaaccgcctgctgcagaccgacgcgggtgacgtc
gccggccgccgtcccaccgccgtcgacccggtcgccggtctgcgccgggcccgcgcggcg
acactcctgctgctggcgctgcccgggtcggcgtacctgttccagggtgaggaactcggt
ctgcccgaggttgtcgacctgccgccggaggtccgccaggacccggccttccaccgcgcc
agcggccaggacggttaccgcgacggctgccgcgtcccgatcccgtgggagggcgaccgc
gcaccgtacggtttcggcccgccggacggcccgagctggctcccgcagccggcctcctgg
gcggcgctcagcgtcgcggcccagcagggcgatcctggctccaccttggagctctaccgc
gccgcactggcgctgcgccgcgcggatccggcgctcggcgcggccgacaacctgagctgg
cgcgacgctccggacggtctgctggtcttcgaccgcgcgccgcacttccgctgcacggtc
aacatgaccgccgccccggtccgcctgccgctgccgggccgcgccctgctgaccagcggc
ccggtcgacctgtccggcaccgaggtggagatccccgccgacacgaccatctggtgggcg
gtctga

DBGET integrated database retrieval system