KEGG   Actinoplanes friuliensis: AFR_18880Help
Entry
AFR_18880         CDS       T02892                                 

Definition
(GenBank) putative beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
afs  Actinoplanes friuliensis
Pathway
afs00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:afs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AFR_18880
Enzymes [BR:afs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AFR_18880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_14 DUF4434 Glyco_hydro_42C Glyco_hydro_35
Motif
Other DBs
NCBI-ProteinID: AGZ42050
UniProt: U5W266
LinkDB All DBs
Position
4130718..4132718
Genome map
AA seq 666 aa AA seqDB search
METSHRWLRPTDPRAGRRLEFGADYNPEQWPRSVWDDDIRAMRVAGVTVVSLAIFSWARL
EPSEGEYTFGWLDEVMDLLHAGGIAVDLATATASPPPWLTTKYPEILPVDRQGATVWPGG
RQHWRPTSPIFREHALRLVRTMAGRYGGHPALTAWHISNELGCHNAYDYSDDAAAAFRTW
LQNRYTGLDALNAAWGTAFWSQHYSEWAQILPPRQAATHPNPTQQLDFKRFSSDALKDYL
RAERAVLRELTPEVPATTNFMVMDSTKALDYADWAAEVDFVANDHYVQRGPRPLDELSFS
ANLTGHLAGGRPWFLMEHSTSAVNWQPINVPKAPGALARDSLTHVAHGADAVCFFQWRQS
VAGAEKYHSAMLPQAGEDSAVFRSVVQLGETLRRLAPLSGTPRSPARAAILFDWTSWWVA
EQDSHPTDRLRYRQEALDWYSAFLDLGVRADVVPVATDLSGYDLVVAPVLHVVPAALAER
LTAFVAGGGHLVTTYFSGIVDENDHLWAGGHPGAFRDLLGLRIEEFGPLPDDEPAELDNG
SAGTLWADHPTVTGTDVTVLAAYRDGSPAVTRRTAGTGSAAYVGTRLGPDGLAPVLGELL
SLAGVGSELPPELRGRVELAIRGDFRFLINRTAGPVELTGLAGEALHGSATLLEARGVTV
LRVDPQ
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
gtggaaacctctcatcgctggctgcgcccgacggatccgcgggccggtcgccggctcgag
ttcggtgcggactacaacccggagcagtggccgaggtccgtgtgggacgacgacatccgg
gccatgcgggtcgcgggggtcaccgtcgtctccctcgcgatcttctcgtgggcgcggctg
gagccgtccgaaggggagtacacgttcggctggctcgacgaggtcatggacctgctgcac
gcgggtggcatcgcggtcgacctggccacggcgaccgcgtccccgccaccgtggctgacc
accaaatacccggagatcctgcccgtcgaccggcagggcgcgacggtctggcccggcggc
cgccagcactggcggcccacctcgcccatcttccgggagcacgcgctgcggctggtccgg
accatggccgggcgctacggcggtcacccggccctgaccgcctggcacatctccaacgag
ctcggctgccacaacgcctacgactactccgacgacgcggccgccgccttccgcacctgg
ctgcagaaccggtacaccggtctcgacgccctcaacgcggcctggggcacagcgttctgg
tcgcagcactacagcgagtgggcgcagatcctgccgccacgtcaggccgccacccatccg
aacccgacccagcagctcgacttcaagcgtttctcgtcggatgcgctcaaggactacctg
cgcgccgagagggcggtcctgcgggagctcacgcccgaggtgccggccacgaccaacttc
atggtcatggacagcacgaaggcgctggactacgccgactgggcggcggaggtcgacttc
gtcgccaacgaccactacgtgcagcggggtccgcggccgctcgacgagctgtcgttctcg
gccaatctgaccgggcacctcgccggcggccgcccgtggttcctgatggaacactcgacc
agcgccgtgaactggcagccgatcaacgtgccgaaagcgcccggtgcgctggcccgggac
tcgctcacccacgtcgcccacggcgcggacgcggtctgcttcttccagtggcggcagtcg
gtcgcgggcgcggagaaataccactcggcgatgctgccgcaggcgggggaggacagcgcg
gtcttccggtcggtggtccagctcggcgagacgctgcgccgtctcgcacccctgtccggt
acgccgcggagtcccgcccgcgcggcgatcctcttcgactggacgtcctggtgggtcgcc
gagcaggactcgcacccgaccgaccggttgcgctaccgccaggaggccctcgactggtat
tccgcctttctcgacctcggcgtgcgcgcggacgtggtgccggtcgcgacggacctgtcc
ggttacgacctcgtggtcgcgccggtgctgcacgtcgtcccggccgctctcgccgaacgc
ctgaccgcctttgtcgccggtggcgggcacctggtcaccacgtacttctcgggcatcgtc
gacgagaacgaccacctctgggccggcggtcatccgggcgcgttccgtgacctgctcggc
ctgcgcatcgaggagttcgggccgctgccggacgacgagccggccgagctcgacaacggc
tccgccggcactctgtgggcggatcaccccacggtcacggggacggacgtcacggtgctg
gcggcgtaccgggacgggtcacctgctgtcacccgccgcaccgccgggacgggctcggcc
gcgtacgtggggacccggctcggtccggacggcctggcgccggtgctcggtgagttgttg
tcgctggccggcgtgggcagtgagctgccgccggagctgcgcggccgggtggagctggcg
atccgcggtgacttccgcttcctgatcaatcgcaccgccgggccggtcgagctgaccggc
ctggcgggcgaggcactccacggctcggcgaccctcctcgaagcgagaggggtcaccgtg
ctgcgtgtcgatcctcagtga

DBGET integrated database retrieval system