KEGG   Actinoplanes friuliensis: AFR_27465Help
Entry
AFR_27465         CDS       T02892                                 

Definition
(GenBank) putative glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
afs  Actinoplanes friuliensis
Pathway
afs00564  Glycerophospholipid metabolism
afs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AFR_27465
Enzymes [BR:afs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AFR_27465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 3HCDH_N AlaDh_PNT_C GIDA NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AGZ43754
UniProt: U5W3P3
LinkDB All DBs
Position
5965096..5966802
Genome map
AA seq 568 aa AA seqDB search
MTDTTLSPAAREAALSALAGNEVDVLVVGGGVVGAGSALDAATRGLSVGLLEARDFASGT
SSRSSKLIHGGLRYLEMLDFALVREALRERGLILTRLAPHLARPVPFLYPLQHRGWERLY
AGAGVLLYDTMAAAAPGLPRHRHLSRRGALRVAPALRRDALVGALQYYDAQLDDARHTMF
LARTAAAYGAHVASRAEVVGFLREGERVTGVRVHDLEHDKTFEVRAQQVINATGVWTDDT
QALVGERGQFHVRASKGIHLVVPRDRIQSATGIISRTPSSVLFIIPWGRHWIVGTTDTDW
TLDKAHPAASSTDIDYLLDQVNKVLATPLTRTDVQGVYAGLRPLLSGESESTSKLSREHT
VGSPTPGLVVVAGGKYTTYRVMARDAVDAAVHGLGRSVPRSCTERVPLLGADGYQALWNR
RRVLADESGLHVARVEHLLGRYGSLIHELLDLIRADPGLGKPVDGADDHLRAELVYAASH
EGARHLEDVLTRRTRISIETFDRGLAAADVAADLMGSVLGWSPDQTDREVRNYRLRVEAE
RASQEQPDDETADAARLGAPEVVPLRTP
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
ttgactgacaccacgctctcaccggccgcgcgggaagccgcgctctccgcgctggccggc
aacgaggtcgacgtgctcgtcgtgggtggcggggtggtgggcgcgggcagtgccctcgac
gccgccacccgcggcctgtccgtcggcctgctcgaggcgcgcgacttcgcctcgggcacg
tccagccggtccagcaaactcatccacggcggcctgcgctacctggagatgctggacttc
gcgctggtccgcgaggccctgcgcgaacgcggcctcatcctgacccggctcgcgccgcac
ctggcccgcccggtccccttcctctatccgttgcagcaccgcggctgggaacgcctctac
gccggcgccggtgtgctgctctacgacacgatggccgcggcggcgcccggcctgccgcgg
caccggcacctctcccggcgcggcgcgctgcgggtcgctccggcgctgcggcgtgacgcc
ctggtcggtgcgttgcagtactacgacgcccagctcgacgacgcccggcacacgatgttc
ctggcccgcaccgccgcggcctacggcgcgcacgtcgcgtcccgcgccgaggtggtggga
ttcctccgggagggcgagcgggtcaccggcgtccgggtccacgacctcgagcacgacaag
accttcgaggtacgcgcgcagcaggtcatcaacgccacgggtgtgtggaccgacgacacc
caggcgctggtcggcgaacgcgggcagttccacgtccgcgcgtccaagggcatccacctg
gtcgtgccccgcgaccgcatccagtcggcgacgggcatcatcagccgcaccccgagcagt
gtcctgttcatcatcccgtggggccggcactggatcgtcggcaccaccgacaccgactgg
acgctggacaaggcgcacccggccgcgtccagcaccgacatcgactacctgctggaccag
gtcaacaaggtgctcgccaccccgctgacccgcaccgacgtccagggtgtctacgccggc
ctgcgcccgctgctctccggcgagtcggagtccacgtcgaagctgtcccgcgagcacacc
gtcggcagccccaccccgggcctggtcgtggtggcgggcggcaagtacacgacctaccgg
gtgatggcccgcgacgccgtcgacgcggcggtgcacgggctgggccgctcggtaccccgg
tcgtgcacggaacgcgtaccgctgctgggcgccgacgggtaccaggcgctgtggaaccgc
cgccgcgtcctggccgacgagtccggcctgcacgtcgcacgggtggaacacctgctcggg
cggtacgggtccctgatccacgagctgctcgacctgatcagggccgatcccggcctcggc
aaaccggtcgacggcgccgacgaccacctgcgggccgagctggtgtacgccgccagccac
gagggcgcccggcacctcgaggacgtcctcacccggcgtacccggatctccatcgagacc
ttcgaccgcggcctggccgcggccgatgtcgcggccgacctgatgggtagcgtcctgggc
tggagccccgaccagaccgaccgcgaggtccggaactaccgcctccgcgtcgaggccgaa
cgcgcctcgcaggaacaaccggacgacgagacggccgacgcggcccgcctcggcgccccc
gaggtggtgcctctccgcaccccctga

DBGET integrated database retrieval system