KEGG   Actinoplanes friuliensis: AFR_28570Help
Entry
AFR_28570         CDS       T02892                                 

Definition
(GenBank) DNA polymerase LigD ligase domain-containing protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
afs  Actinoplanes friuliensis
Pathway
afs03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:afs00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AFR_28570
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:afs03400]
    AFR_28570
Enzymes [BR:afs01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AFR_28570
DNA repair and recombination proteins [BR:afs03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AFR_28570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase FAM178
Motif
Other DBs
NCBI-ProteinID: AGZ43975
UniProt: U5W7K1
LinkDB All DBs
Position
complement(6214880..6216049)
Genome map
AA seq 389 aa AA seqDB search
MSAGEVIEPMLATLGEPPAGDDVALEFKWDGIRCLAYVDDGVRLFSRNGRDITTGYPELA
ELVPLAAGHRVVLDGELVALDSAGVASFERLQQRMHLSAPAPALVTAVPVVYEVFDLLFL
DGEATTALPYLQRRELLAGLDLAGDAVRVPAHFVNADPAAVLTAARSQGLEGIVAKRLGS
TYQSGRRSRDWIKVPFNQTQEIVVIGWKPGGGRRSGTIGSLLTAVTGPDGNLAYAGGVGT
GFTQAMLEQLQGMLAPLSRPTPAVAGIPRVDARGARWVEPVIVGEVSFRNWTGDGKMRHP
SWRGLRPDKSPARVPRVTPPVETIDGVMQTLGGSWRVEVVRRGSVTSYRIVHGEDVIDWL
PDIADVERILTRAGVAMEALQPAQRRTSA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccggcgaggtgatcgagccgatgctggccacgctcggggagccgccggccggg
gacgacgtcgcgctggagttcaagtgggacggcatccgctgcctcgcctacgtcgacgac
ggcgtgcggttgttctcgcggaacggccgggacatcaccaccggttaccccgagctggcc
gagctggtacccctcgcggccgggcatcgtgtggtcctcgacggggagctcgtcgccctg
gattccgcgggggtcgcctcgttcgagcggctgcagcagcgcatgcacctcagcgcacct
gcgccggcgctcgtcaccgccgtaccggtggtctatgaagtctttgacctgctgtttctt
gacggtgaggccacgaccgcgctgccttatctccagcgtcgcgagctgctggccggtctt
gatctggccggtgatgcggtgcgcgtcccggcgcattttgtgaacgccgacccggcggcg
gtgctgaccgccgcccgcagccagggcctcgaggggatcgtcgccaagcggctggggtcg
acctaccagagcggccggcgctcccgcgactggatcaaggtgccgttcaaccagacccag
gagatcgtggtcatcggctggaaacccggcggcggacgccgctccgggaccatcggttcg
ctcctgaccgcggtcaccggacctgacggcaacctcgcgtacgccgggggagtgggcacg
ggcttcacccaggcgatgctcgagcagctccagggcatgctggcgccgctgagccgcccc
acacccgcggtggcgggcataccgcgtgtcgatgcgcggggtgcccgctgggtggaaccg
gtgatcgtcggtgaggtgtcgttccggaactggaccggcgacggcaagatgcgccacccg
tcgtggcgtggtctgcggccggacaagagcccggcgcgggtgccccgggtgacaccaccg
gtcgagacgatcgacggtgtcatgcagaccctcggcggctcgtggcgggtcgaggtggtg
cgccgcggcagcgtcacgtcgtaccggatcgtgcacggtgaggacgtgatcgactggctg
ccggacatcgccgacgtcgagcgcatcctgacccgcgccggggtggcaatggaagctctg
cagcccgcccagcgccggacatcggcttag

DBGET integrated database retrieval system