KEGG   Actinoplanes friuliensis: AFR_34755Help
Entry
AFR_34755         CDS       T02892                                 

Definition
(GenBank) alcohol dehydrogenase GroES domain-containing protein
Organism
afs  Actinoplanes friuliensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C Shikimate_DH Sacchrp_dh_NADP ADH_N_2 F420_oxidored Semialdhyde_dh AlaDh_PNT_C NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGZ45207
UniProt: U5W873
LinkDB All DBs
Position
7592029..7593057
Genome map
AA seq 342 aa AA seqDB search
MMRVVVTPDRVQVVEAAVPSPGPGEVLLRTLVAGVCGSDTHALRGRHPNVTPPYAPGHEV
VGVVVEVAPDVTAVSVGQRVIVEPDLPCWSCKQCLAGRQNLCENLGFFGCGSEQGGMSDQ
FTIDVRRLHVVPDGLDDRTAALIEPVSTPVHAIRLAGDVKDRAVAILGAGTIGLLTLKVA
KAHGAGRVVMTARSARSRERALAFGADAVVDATATDAADQVRAALGESADVVFDCVAEQS
TTLQALRIADKGGTVVVVGVPAGDVQIPLALLQDSQLRIQGSATYLPEDYTDAMTLLADG
TVRASDFVTAVRPLTEAAEAFADAESTAHIKVLLAPNPDELR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcgtcgtcgtgaccccggacagagtgcaggtcgtcgaggcggcggttccgtca
cccggacccggcgaggtactgctgcggaccctcgtcgccggcgtctgcgggtcggacacc
cacgcgttgcgcgggcggcatccgaacgtgactcccccgtacgccccgggtcacgaggtt
gtcggtgtggtcgtcgaggtggcaccggacgtgaccgcggtgagcgtcggtcagcgggtg
atcgtcgagccggatctgccctgctggagctgcaagcagtgcctcgccggccggcagaac
ctgtgcgagaacctgggctttttcggttgcggctcggagcagggcggcatgtccgaccag
ttcacgatcgacgtccgccgcttgcacgtcgtcccggacggtctcgacgacaggacggcc
gccctgatcgagccggtctccacgccggtgcacgcgatccggctggccggtgacgtgaag
gaccgcgcggtggccatcctcggtgcgggcacgatcggtctgctgaccctgaaggtcgcc
aaggcccacggtgccggccgtgtggtgatgacggcccggtccgcgcggagccgggagcgg
gccctggccttcggggccgacgcggtcgtcgacgcgaccgccaccgatgccgccgaccag
gtccgcgccgccctcggggagagcgcggacgtcgtcttcgactgcgtcgccgagcagtcg
accaccctgcaggccctgcggatcgccgacaagggcggcacggtggtggtcgtgggggtg
ccggcgggtgacgtccagatccccctcgccctgctgcaggacagccagctgcggatccag
ggcagcgcgacctacctgcccgaggactacacggacgcgatgacgctcctggccgacggc
acggtccgcgcctccgacttcgtcacggccgtccgtcctctcaccgaggcggccgaggcg
ttcgcggacgccgagagcaccgcgcacatcaaggtgctcctcgccccgaacccggacgaa
ctacgctga

DBGET integrated database retrieval system