KEGG   Actinoplanes friuliensis: AFR_35055Help
Entry
AFR_35055         CDS       T02892                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
afs  Actinoplanes friuliensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C LZ_Tnp_IS481
Motif
Other DBs
NCBI-ProteinID: AGZ45267
UniProt: U5W8D4
LinkDB All DBs
Position
7653702..7654769
Genome map
AA seq 355 aa AA seqDB search
MDLPINPPVKPMLAKPVADIPPGQLYEPKWDGFRSIIFRDGDEVEIGSRNEKPMTRYFPE
VVQAVLANFPPRSVIDGEIIVADTARNTLDFEALQQRIHPAASRVKLLSEQTPAGFVAFD
LLALGDEDLTTLPFAERRARLEQCLADAKPPVYVTPATDELETAQRWFAEFEGAGLDGLI
AKAKDLEYVPDKRVMTKIKHKRTADCVVAGYRVHKSAENRIGSLLLGLFDERDVLVSVGV
IGSFPMAVREELFTEMQHLVTTFEGHPWNWAAHEQGERTPRKNEVSRWNNGKDLSFIPLR
PERVVEVRYDYMEGLRFRHTAQFERWRPDREPRSCTYEQLERPVRFNLADVLTSR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggacctgccgatcaacccgcccgtcaagccgatgctggccaagcccgtcgccgacatc
ccgccggggcagctctacgagcccaagtgggacggtttccggtcgatcatcttccgcgac
ggtgacgaggtggagatcggcagccgcaacgagaagccgatgacccgctatttccccgag
gtcgtgcaggccgtgctggcgaacttcccgccccggtcggtgatcgacggcgagatcatc
gtcgccgacacggcccgcaacaccctcgacttcgaggcgttgcagcagcgcatccacccc
gcggcgagccgggtcaagctgctttccgagcagacgccggccggttttgtggccttcgac
ctgctggcgctgggtgacgaggatctgaccacgctgcccttcgccgagcgccgcgcgcgc
ctcgagcagtgcctcgccgacgcgaagccgcccgtttacgtcaccccggccacggacgag
ctcgagaccgcccagcggtggttcgccgagttcgagggtgccggcctggacggcctcatc
gccaaggccaaggatctcgagtacgtgccggacaagcgcgtcatgaccaagatcaagcac
aagcggacggccgactgtgtcgttgcggggtaccgcgtgcacaagtcggcggagaaccgc
atcggctcgctgctgctgggcctcttcgacgagcgggacgtgctggtctcggtcggtgtc
atcggctcgttcccgatggcggtccgcgaggagctcttcacggagatgcagcacctggtc
accacgttcgaaggacacccgtggaactgggcggcgcacgagcagggcgagcgcaccccg
cgcaagaacgaggtcagccgctggaacaacggcaaggacctgtccttcatcccgctgcgg
ccggagcgtgtggtcgaggtgcgctacgactacatggagggcctgaggttccggcacacc
gcgcagttcgagcgctggcgtcccgaccgggagccgcgctcgtgcacctacgagcagctc
gagcggccggtccgcttcaacctcgcggacgtgctcacgagccgctga

DBGET integrated database retrieval system