KEGG   Actinoplanes friuliensis: AFR_38030Help
Entry
AFR_38030         CDS       T02892                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
afs  Actinoplanes friuliensis
Brite
KEGG Orthology (KO) [BR:afs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AFR_38030
Enzymes [BR:afs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AFR_38030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni Phage_clamp_A
Motif
Other DBs
NCBI-ProteinID: AGZ45860
UniProt: U5WCX1
LinkDB All DBs
Position
8299161..8299565
Genome map
AA seq 134 aa AA seqDB search
MRLPRIFTPRTVVSAHCDLPCGVYDPAQARIEAESVKAIAEKYQANTDPEFRTRAILIKE
QRAELVKHHLWVLWTDYFKAPHFEKYPNLNQLFNEATKLAGASGAKGSMDPKVGEELLGK
IEEISKIFWETKQA
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttccgcgcattttcacgccgcgcactgttgtcagtgcgcactgcgacctgccg
tgtggggtgtacgaccccgcgcaggctcgtatcgaggcggagtcggtgaaggccatcgcc
gagaagtaccaggcgaacaccgaccccgagttccgcacccgcgccatcctgatcaaggag
cagcgcgccgagctggtcaagcaccacctgtgggtgctctggaccgactacttcaaggcg
ccgcacttcgagaagtacccgaacctgaaccagctgttcaacgaggccaccaagctcgcg
ggcgcttccggcgccaagggctcgatggacccgaaggtcggcgaggagctcctcggcaag
atcgaggagatctcgaagatcttctgggagaccaagcaggcgtga

DBGET integrated database retrieval system