KEGG   Actinoplanes friuliensis: AFR_39615Help
Entry
AFR_39615         CDS       T02892                                 

Definition
(GenBank) hypothetical protein
  KO
K07058  membrane protein
Organism
afs  Actinoplanes friuliensis
Brite
KEGG Orthology (KO) [BR:afs00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    AFR_39615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: AGZ46177
UniProt: U5WB07
LinkDB All DBs
Position
complement(8635588..8636526)
Genome map
AA seq 312 aa AA seqDB search
MGTVGGVNVIDRAYAAVEARVMALRHRSAYFDHFCRAILRYDEVLGGRLAAAIAYYGFFA
VFALALIGYSIFGFLIKSNIGLFEIVQEFLGQNLPFLDVQAILDSGRTVGIVGIVGLVFT
GIGWVEAIRSSQRLIWRLNEQPGYIGVRQVVDLLVMIGILLLLAISVFAVYGLEALLAWI
ADGHVSFLRSAVSLILTVGINMLLAAALLAAVPRLRMTVRRMAPPVLQVGIGITLLNTVG
KSFVGLVERNPAYGLVASAVGVLVYLYVFNQLLLFGAAWAATSPHGRVVDLSADDKTAPV
GQNTWIRNDRPE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
ttgggtacggtcggcggcgtgaacgtcatcgaccgggcgtacgcggcggtcgaggcccgg
gtcatggcgctgcggcaccgctccgcgtatttcgaccacttctgccgcgcgatcctgcgg
tacgacgaggtgctcggcggccggctcgccgcggccatcgcgtactacggcttcttcgcg
gtttttgccctggccctgatcggatattcgatcttcggtttcctgatcaaatcgaacatc
gggctgttcgagatcgtccaggagttcctggggcaaaaccttcccttcctcgacgtgcag
gcgatcctggacagcggccggaccgtcggcatcgtgggcatcgtcggcctggtcttcacc
ggcatcggctgggtcgaggcgatccgcagctcgcagcggctgatctggcgcctgaacgag
cagcccggctacatcggtgtccggcaggtggtcgacctgctggtgatgatcggcatcctg
ctgctgctcgccatctcggtgttcgcggtctacgggctcgaggcgctgctcgcctggatc
gctgacgggcacgtgtcgttcctgcggtcggcggtcagtctgatcctcaccgtcggcatc
aacatgctgctcgccgcggcactgctggccgcggtgccgcgattgcggatgaccgtgcgc
cgcatggcgccgccggtgctgcaggtcggcatcggcatcacgctgctgaacaccgtcggc
aagtcgttcgtcggcctcgtggagcgcaatcccgcgtacggcctggtcgcgagtgccgtc
ggcgtgctcgtctacctctatgtcttcaaccagttgctgctcttcggggcagcctgggcg
gcgaccagtccgcacggtcgtgtggtggacctgtcggctgacgataaaactgccccggtg
gggcaaaatacctggattcggaacgaccgcccggaatga

DBGET integrated database retrieval system