KEGG   Anoxybacter fermentans: BBF96_05850Help
Entry
BBF96_05850       CDS       T05768                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
aft  Anoxybacter fermentans
Brite
KEGG Orthology (KO) [BR:aft00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aft01001]
    BBF96_05850
Enzymes [BR:aft01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BBF96_05850
Protein kinases [BR:aft01001]
 Serine/threonine kinases: Other
  Bacterial family
   BBF96_05850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like RIO1 Pkinase_fungal Kdo
Motif
Other DBs
NCBI-ProteinID: AZR72958
UniProt: A0A3Q9HQ05
LinkDB All DBs
Position
complement(1321904..1323811)
Genome map
AA seq 635 aa AA seqDB search
MIGKVLNGRYELTEILGEGGMALVYKARDLILDRWVALKILRPQLVSDKDFVKRFHREAK
AVARLSHPNVVNIYDIGQDGDIHYLVMENIQGENLKEKIQREGILDPAEALDIAIQICEA
LVVAHRNNIIHCDIKPHNILITPEGGVKVTDFGIARAVNSATLAQTETVIGTAHYFSPEQ
ARGGTINARSDLYSLGVVLYEMLTGQVPFRGDSPITVALKHINEEPLPPSQLNEKLPKRI
DKLVMKALHKDPDKRFANASEMLNALRGMVKTFERKDGDEIKTYLDSDETQVLPRISDQH
YNKTAAGHEVKERKGSGFVRFVKIMLILLFTFIILGAVGFWALEQYTKVPVVKVPDFIGL
SKEEAQQKAREIGLRVIFNEFKVSSPEIPADHVVSQDIEAGKEVKKNRVIMLTLSKGATM
TTVPNLIGLEMREVKVALHEADLVLGEVEYQFTDKIPKGQVMTQDPPANEQVKSGTKVNL
IFSKGSEPIMGTIPNVIGLSRKEAERRIEEANFVVGEIIEEETTRFLAGQVANQNPVAGT
VAPEGTPINLTISKGLRNPKGSSTYSFTATINVSEGSYNQKIQVVVIDDNGRDIIYDKVH
HPGDHIVIRDIHTVGPTILQVFINGELVREERYGF
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgattgggaaagtgttaaacggcagatatgaattgacagaaattttgggagaaggggga
atggccctggtctataaagccagggatttaatcctggaccgttgggttgctttaaaaatt
ttacgtccccagttggtttcagacaaggattttgttaaacggtttcatagagaagccaaa
gctgttgcccgactttcccatcccaatgtggtaaatatttatgatattggtcaggacggg
gatattcattatctggttatggaaaatatccagggagaaaatttaaaagaaaagattcaa
agagaagggattttagatccggctgaagctttagatattgctattcagatctgtgaagct
ttagttgttgcccatcgcaataatattattcactgtgatattaagccccacaatattttg
attacaccagagggtggtgtgaaggttacagattttgggattgcacgggcagtaaattca
gctaccctggcccagacagagacggtgattggtacagcccactatttctccccagaacag
gccagaggtggaactatcaatgccagatcggatctttattctttaggggttgtcttatat
gaaatgcttaccggacaggttcccttccgtggtgatagccccattacagtagctttaaag
catatcaatgaagagccattgccgccaagtcagctaaatgaaaaattaccaaaacgtatt
gacaaattggtgatgaaggcccttcataaagatcccgataaacggtttgccaatgcttct
gagatgctcaatgctttacggggaatggttaagacctttgagagaaaagatggggatgag
attaagacctatctggatagtgacgaaactcaggttttaccacggatttcggatcagcac
tataataaaacagcggcgggtcatgaagttaaagaaagaaaaggttctgggtttgtccgg
tttgtcaaaatcatgctcattctactttttacatttattatcctgggagcagtcggtttt
tgggctttagagcaatatacaaaagtacctgtagttaaagttcctgattttataggttta
agtaaagaagaggcccaacagaaggccagagagattggattaagggtaattttcaatgaa
tttaaagtatcaagtccggaaattcctgctgatcatgttgtttcccaggatattgaagca
ggtaaagaagtaaagaaaaatcgtgtgattatgttgaccttaagtaaaggcgctaccatg
acaacagttccgaatttgattggtctggagatgcgtgaagtaaaagtagccttgcatgag
gctgatctggtgttaggggaagtggaatatcaatttacagataagattcccaagggccag
gtaatgacccaggatcctccagccaatgaacaggtgaagagtgggacaaaggtaaattta
atctttagtaaaggatctgaaccgattatgggaacgattcccaatgttattggactcagt
cgaaaggaagctgaacgtagaattgaagaagccaactttgtagttggtgagattatagaa
gaagagactaccaggtttttagctggtcaggtagcaaatcaaaatcctgtagctggtacc
gtggcacctgaaggaacacccatcaatctaactatcagtaaaggattgagaaatcccaag
ggttcatctacctattcttttactgctacaattaatgtttcagaaggttcttataaccag
aagattcaagttgtggtaattgatgataatggtcgggatataatttatgataaagttcat
catccaggagatcatattgttattagggatatccatactgttggacctacaattcttcag
gtctttattaatggagagttggtcagagaagaaagatatggtttttag

DBGET integrated database retrieval system