KEGG   Anoxybacter fermentans: BBF96_11855Help
Entry
BBF96_11855       CDS       T05768                                 

Definition
(GenBank) bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
aft  Anoxybacter fermentans
Pathway
aft00340  Histidine metabolism
aft01100  Metabolic pathways
aft01110  Biosynthesis of secondary metabolites
aft01230  Biosynthesis of amino acids
Module
aft_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:aft00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BBF96_11855
Enzymes [BR:aft01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     BBF96_11855
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BBF96_11855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG MazG-like SH3_9 SH3_1
Motif
Other DBs
NCBI-ProteinID: AZR74916
UniProt: A0A3S9T2Z8
LinkDB All DBs
Position
complement(2618671..2619309)
Genome map
AA seq 212 aa AA seqDB search
MEVKAKDLDQLCFDEKTGLIPAIIQDWKSKRVLMLAYMNRESLELSLKTGETWFFSRSRQ
KLWHKGETSGNVQKIKAISYDCDKDTLLVEVIAEGPACHTGEDSCFYRQLAGEKSSLTVN
EVISSLFTLIQDRKTNPVEGSYTNYLFKEGLDKILKKVGEETAEVIIGAKNQSKEEFIYE
MADLVYHLLVLTAEMGCRPEDIAEELARRFKK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggaggttaaagctaaagatttagatcaactgtgctttgatgagaaaacgggtctgatt
cctgcaattattcaggattggaagagtaaaagagtattgatgctcgcttatatgaatagg
gaatctctggaattgagccttaagaccggagagacctggtttttcagccggagccgtcaa
aaactctggcataagggagagacttcgggcaatgtgcaaaagataaaagctatctcttat
gactgtgataaagatactcttctggtggaggttattgcagagggcccggcctgccataca
ggggaagatagctgtttttatcgtcagttggctggtgagaagtcttccctgacagttaat
gaggtgatttcatcactatttaccctgattcaggataggaaaaccaatccggtggaaggt
tcatataccaattatctttttaaggaaggtctggataagattttaaaaaaggtgggggaa
gaaacggcagaagtgattattggtgctaaaaatcagtctaaagaggaatttatctatgag
atggctgatcttgtgtatcatctgttggttcttacagctgaaatgggttgtaggcctgag
gatattgcagaggagttggcccgtcggtttaagaaatag

DBGET integrated database retrieval system