KEGG   Archaeoglobus fulgidus DSM 4304: AF_0394
Entry
AF_0394           CDS       T00011                                 

Definition
(GenBank) D-lactate dehydrogenase, cytochrome-type (dld)
  KO
K21836  D-lactate dehydrogenase (acceptor) [EC:1.1.99.6]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
afu00620  Pyruvate metabolism
afu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AF_0394
Enzymes [BR:afu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.99  With unknown physiological acceptors
    1.1.99.6  D-lactate dehydrogenase (acceptor)
     AF_0394
SSDB
Motif
Pfam: FAD-oxidase_C FAD_binding_4
Other DBs
NCBI-ProteinID: AAB90839
UniProt: O29853
LinkDB
Position
complement(358025..359356)
AA seq 443 aa
MSWIDELSKIVEVFPPSDAYRFDETPPLVAPRAAENFVVVKPSNSEEVSAILKFANEKSI
PVFMRGGGTGLSGGAVPTEEGIVLSTEKMTELEVDADNRVAICGAGVTLKQLDDAAFRHG
LSFPPHPGAETATVGGMIATNAGGVRALKYGTMRNYVLSLEAVLADGRIINVGGKTIKNS
SGYSLLHLLVGSEGTLAVITKATIRLFPQMRDMTVLAIPFPTMEDAMNCVVEVARKMLPM
ALEFMEKRAVEIGEKVSGERWVSREGEAHLLMVFESFDEAEEAAKIAQSLGAIDVYAATT
KKDQDRLLKVRGMIYEGLRKEVIEVLDACVPPAKIAEYWRRSNELAEEYGIELITYGHAG
DGNVHQHPLVYEGWEKSYFEFRKSLLSLAVSLGGVISGEHGIGAVKLSELEELFPEQFEL
MRQIKLLFDPKNILNPGKVVRKL
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgagctggattgatgagctttcaaaaattgttgaggtctttccaccatcggacgcttat
cgcttcgatgaaactccacctctcgttgctcccagagcagctgaaaatttcgttgtggtg
aagcccagcaacagcgaggaggtctcggcgattttgaagttcgccaacgaaaaaagtata
ccagttttcatgaggggcggtgggactgggcttagcggcggggctgtgccgactgaggag
ggcattgtactctcaactgaaaaaatgacagagcttgaggttgatgccgacaacagagtt
gctatttgcggtgcgggagttactttgaagcagcttgacgatgcagccttcaggcacggc
ttgagcttcccgccccatcccggagctgaaaccgcaacagtcggagggatgattgcaacc
aacgctgggggagtgagggctttgaagtacggaaccatgaggaactacgttctcagcctc
gaagctgttcttgccgacggcaggataatcaatgttggcgggaaaacgataaagaactcc
tcgggctactctctccttcaccttcttgtggggagtgaggggacgcttgcagtgataact
aaggcaacaattcgccttttcccgcagatgagggacatgactgtcctcgccatccccttt
ccgacgatggaggatgctatgaactgcgttgttgaggttgcgagaaaaatgctccccatg
gccctcgaattcatggaaaagagggcagttgagattggggagaaggttagcggggagagg
tgggtgagcagggagggggaggcacacctcctgatggtcttcgagagctttgatgaggcc
gaggaggctgcaaaaattgcccagtcgcttggagcgattgacgtttacgcagcaaccaca
aagaaggatcaggacaggctgctgaaagtgaggggaatgatttacgaggggctgagaaag
gaggtcattgaggttctcgacgcctgcgttcctccagctaaaattgccgagtactggaga
aggagcaacgagcttgctgaagaatatggcatcgagctaataacctacggccatgctgga
gatggcaacgtccaccagcacccgctggtttacgagggatgggagaaaagctactttgag
ttcagaaagtccctcctcagcctcgctgtcagccttggcggtgtgatcagcggcgagcac
ggtataggggcggttaagctttcggagctagaggagctgtttccagagcagttcgagctg
atgagacaaatcaagctcctcttcgacccaaaaaacatcctcaaccccggcaaggttgtt
cgcaaactataa

DBGET integrated database retrieval system