KEGG   Archaeoglobus fulgidus DSM 4304: AF_0849Help
Entry
AF_0849           CDS       T00011                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Brite
KEGG Orthology (KO) [BR:afu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AF_0849
Enzymes [BR:afu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AF_0849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AAB90388
UniProt: O29409
LinkDB All DBs
Position
755022..756158
Genome map
AA seq 378 aa AA seqDB search
MNFIAQALNLSKSAAGRLEERNILRKAFVRHPFFADIEEAFRFEKKFGQYEEGTIVIKAK
DSLKVFRGFPKIRRALLLDPTIKKHFGDREVVLEEKMNGYNVRIVKVGDNLYAITRRGLI
CPYTTEKARTLIDDEFFRDYPDYMLCCEAVGRASPYVPTDVYGIETLEFFLFDVREGKTN
QPVTIDEKKEIAEKYGFRLAEILETVSSDDVARIKEVVEKLNKNRREGVVFKDREMVLNP
LKYTTSYANQSDLRYAFRFFGEYGRDFMLSRVIREAFQSFEFEEGEEDFNQRCLRLGRAI
LEPMIESIRECKRGEMVCEESELVFESPDVLELFKLHMKLLGVDFRIEVLDGGRVKLKRI
MRSTSDRIRGILQGSTWR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaattttattgctcaggctttaaatttatcgaaatcagcagccggaaggctggaagag
agaaatattctcagaaaggcgtttgtcaggcaccctttttttgccgatattgaggaggcc
ttcagattcgaaaaaaagtttggccagtatgaagaggggactatagtaataaaggctaag
gattctctaaaggttttcaggggctttcccaagataaggagggcgctgctgctcgatcca
acgataaaaaagcacttcggcgatagagaggtggtgcttgaggagaagatgaacggctac
aacgtcagaattgtcaaagtcggggacaacctttatgccatcaccagaagggggctcatt
tgcccctacacaacagagaaggcgagaactctcatagacgacgagttcttcagggactat
cccgattacatgctgtgctgcgaggccgttgggagagcctcaccctacgtccctacggac
gtttacggcatagaaacccttgaattctttctcttcgatgtcagggagggaaaaaccaac
cagcctgtaacgattgacgagaaaaaggaaattgcggagaaatacggtttcaggcttgct
gaaattctcgaaaccgttagctccgacgacgttgcgaggataaaagaggttgtggagaag
ctgaacaaaaaccgaagggagggggttgtttttaaagaccgcgagatggtgctgaatccg
ttaaagtacaccacaagctacgctaatcagtcggatctgaggtatgcgttcaggtttttc
ggggagtacggcagagacttcatgctgtcgagagtaatcagggaagcattccagagcttt
gagtttgaggaaggggaggaggacttcaatcagagatgcctcaggcttggcagggctata
cttgaaccgatgatagagagcatcagggagtgcaagcggggggagatggtttgcgaggag
agcgagcttgtgtttgaaagcccagacgtccttgaacttttcaaactccacatgaagctg
ctcggagttgacttcagaatcgaggttctggacgggggaagggtaaagttaaaaagaatc
atgcgaagtacaagtgacaggataaggggcatacttcaaggctcaacctggaggtag

DBGET integrated database retrieval system