KEGG   Archaeoglobus fulgidus DSM 4304: AF_1032Help
Entry
AF_1032           CDS       T00011                                 

Definition
(GenBank) purine NTPase, putative
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
afu  Archaeoglobus fulgidus DSM 4304
Brite
KEGG Orthology (KO) [BR:afu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:afu03400]
    AF_1032
DNA repair and recombination proteins [BR:afu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AF_1032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rad50_zn_hook AAA_23 SMC_N AAA_15 AAA_29 AAA_27 GAS Baculo_PEP_C AAA_21 NPV_P10 AAA_13 BLOC1_2 DUF3251 PI_PP_I SbcCD_C DUF948 Laminin_II ABC_tran Spc7 Fib_alpha DUF1664
Motif
Other DBs
NCBI-ProteinID: AAB90211
UniProt: O29230
LinkDB All DBs
Position
936303..938963
Genome map
AA seq 886 aa AA seqDB search
MILLKELQIKNFRSHSDSKIEFDTGINLIAGRNGAGKSSILEAILVAFYGLKPATLRKND
LVRVNSSGYSLSLTFSLNGDDYTISRKSNGESILTGKEIVEGDSNITEWVERHLCPAHVF
TGAIYVRQGEIDSIIRDDESRERIIRQITRIEDYENAWKNLGAVIRMLEREKERLKEFLS
QEEQIKRQKEEKKAEIERISEEIKSIESLREKLSEEVRNLESRLKELEEHKSRLESLRKQ
ESSVLQEVRGLEEKLRELEKQLKEVVERIEDLEKKAKEVKELKPKAERYSILEKLLSEIN
QALRDVEKREGDLTREAAGIQAQLKKAEEDNSKLEEITKRIEELERELERFEKSHRLLET
LKPKMDRMQGIKAKLEEKNLTPDKVEKMYDLLSKAKEEEKEITEKLKKLIAKKSSLKTRG
AQLKKAVEELKSAERTCPVCGRELDEEHRKNIMAEYTREMKRIAEELAKADEIEKKLKER
LEKVEKALEKQETVLKYRQMVDELKALENELSSHDAEKLSAESEEYRKVKERLDGLRGQQ
KILLSSASRIKELKSSLREIEEALKNVESERGELHRKIREEGFESLEELEREVQSLRPFY
NKWLELKDAESRLESELKRREKLEDEISEAIAKLEEANGKAEEIRGQIDELLRIYSEEEH
RRLSDEHLRKSKELAGLKSRLETLRESLQSAEKDLKFLEEQLAKMDEYRKKVEVFEKIAI
PELTRIREKFRKYRNLVAENSMREVERYASQIFEELTEGKYSGVRLKKTTERGKEKLKVF
VVYQGEEREIGFLSGGEIIALGLAFRLALSMFMIRGKIPLLILDEPTPFLDEERRRKLVD
ITTNYLRKIPQVIIVSHDEELKDAADKVIFVESQGGVSRVRYVEAQ
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgattctgctcaaggagcttcaaatcaaaaacttccgctcccactcagactctaaaatt
gagtttgacaccggaatcaacctcattgcggggagaaatggtgcgggaaagagctcgata
cttgaggcaattctcgttgccttctacggattgaagcccgccacgttgagaaaaaacgac
cttgtgagggtgaacagctcaggatactcgctcagcctgaccttttctttaaacggtgat
gattacacaatttcaagaaagagcaacggtgagtcaattttaacgggaaaggagattgtg
gagggagacagcaacataacggagtgggttgaaaggcacctctgccctgcacacgttttt
acgggggcaatttacgtcaggcagggagagatagacagcataatcagggacgatgagagc
agggagaggattataaggcagattacgagaattgaggactacgagaacgcctggaaaaat
cttggagctgtaataagaatgcttgaaagggagaaagagaggttaaaagaattcctaagc
caggaagagcagattaaaaggcagaaggaagagaaaaaagctgaaatcgagagaatcagt
gaggaaatcaaaagcatcgagagcttgagggaaaagctttcggaggaggtcagaaatctt
gaaagcagactaaaggagctcgaagagcacaaaagcaggctcgaatctttgagaaagcag
gagagctccgttcttcaggaagtgcggggactggaggagaaactgagggagcttgaaaag
cagctgaaagaggtggtggagagaatcgaagatttggaaaaaaaggcgaaagaggtcaag
gagctgaagccaaaggcggaaagatactcaattcttgaaaaacttctctcagaaataaac
caggctctcagagatgtcgaaaaaagggagggggatttgacgagggaggccgcgggaatt
caggctcagctaaagaaagccgaggaagataacagcaagcttgaggagataacgaagaga
attgaggaacttgaaagggaactggagaggtttgaaaaaagccacaggctgctggagact
ctcaaaccgaagatggatagaatgcaaggcataaaggcaaaacttgaggaaaagaacctc
acacctgataaagttgaaaaaatgtacgatttgctctcaaaagcaaaagaggaggaaaag
gagatcactgaaaagctcaaaaagctgatcgcgaagaagtcgtctttgaagacgagaggt
gctcagctgaagaaggctgttgaggagctgaagtccgctgaaagaacatgtcccgtttgc
ggaagggagcttgacgaagagcacagaaagaatataatggcggaatacacgcgagaaatg
aaaagaattgccgaagagctggcaaaagctgatgaaattgagaaaaagcttaaagagagg
ctggagaaggtcgaaaaggctcttgaaaagcaggagactgttctaaagtacaggcagatg
gtagatgagctcaaagccctggaaaatgagctgtcctcccatgacgctgaaaaactctct
gcggagagcgaagagtacagaaaagttaaggagaggctcgacgggctcagagggcagcag
aagattcttctcagctccgcaagcaggattaaagagctgaagagctcgctaagagagatt
gaagaagctctcaaaaatgtggaaagcgaaaggggggagcttcacaggaaaatcagggag
gaggggtttgagagccttgaagagctcgaaagggaggttcagagcctaagacctttctac
aacaagtggctcgagctgaaggatgcggaaagcaggcttgaaagcgagctaaaaaggagg
gaaaaacttgaggatgagatttccgaagctatagcaaaacttgaggaggctaacggaaag
gctgaggaaatccgcggtcaaatcgatgagctgctgaggatttacagtgaggaagagcac
agaaggttgagcgacgagcacttgaggaaatcgaaggagcttgctggattgaaaagcagg
cttgagactttaagagaatctctgcaaagcgcagaaaaagacttgaagtttctggaggag
cagcttgcaaagatggatgagtacagaaagaaggtggaagttttcgagaaaatcgcgatt
cctgagctgaccagaattagagaaaagttcagaaaatacagaaatctggttgcggagaac
tcgatgagggaagtcgagaggtacgcgagccagatcttcgaggagctgacggaagggaag
tactctggggtaaggctgaagaaaacgaccgagaggggaaaggagaagctcaaggttttc
gttgtttaccagggtgaggagagggagataggatttttgagcggtggagagattattgct
ctcggcctcgccttcaggcttgctctctccatgttcatgataaggggcaagatacccctc
ctcatactcgacgaaccgactccgtttctcgatgaggagaggaggaggaagctcgttgac
atcacgaccaactaccttaggaagatacctcaggttataatcgtatcccacgatgaggag
ctgaaggatgccgccgataaggtgattttcgtcgagtctcaggggggagtttcgagggtc
agatatgtggaggctcagtga

DBGET integrated database retrieval system