KEGG   Archaeoglobus fulgidus DSM 4304: AF_1486Help
Entry
AF_1486           CDS       T00011                                 

Definition
(GenBank) predicted coding region AF_1486
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
afu00620  Pyruvate metabolism
afu00680  Methane metabolism
afu00720  Carbon fixation pathways in prokaryotes
afu01100  Metabolic pathways
afu01120  Microbial metabolism in diverse environments
afu01200  Carbon metabolism
Module
afu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:afu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AF_1486
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    AF_1486
   00680 Methane metabolism
    AF_1486
Enzymes [BR:afu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AF_1486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AAB89769
UniProt: O28786
LinkDB All DBs
Position
complement(1342833..1344248)
Genome map
AA seq 471 aa AA seqDB search
MVPRVMSTQHPDNARIPFFAASEVLNGEDEVREAYYVFSHFKCDEQMWDFEGKEADAHIV
RKLLSSYYDFFSSRPLGKDFRLTMRVPNPEIEKGEAKLLAETLEMIPRSYDYVRSLGIEH
PPIFEVILPMTRSAEEVMKVHAFYRDFVAGKGRFELLGEKVSDWLGDFLPEEIKVIPLFE
DRDSLMRAAEISERYAEWAELDELRVFLARSDPAMNYGFVAATIYVKKALYDLSQLGIST
YPILGVGSCPFRGGFSPKNLSVLDEFPSVYTFTVQSAFKYDYEFGDVRRAIKRAKEAARR
KSDYVDEEHLQVAEKLKDGYRRRIAKIAEIVNRISSRIPRRRMRKLHVGLFGYSRGEEIK
LPRAITFCASLYSIGLPSEIIGIAEMSDKDYEAVCEVFKNFDGMMESAMSLFNPESLKIV
DLSMDFERAKELFGYEPDERHLEKTNEIIKQIDGDIKNLVVEAGILRGFLG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggttccgagggtgatgagcacgcagcacccagacaacgccagaattcccttcttcgca
gcatctgaggtgttgaacggcgaggatgaggtaagagaggcttactacgttttttctcac
tttaagtgcgacgagcagatgtgggacttcgaggggaaggaggcagatgcacacattgtg
agaaaacttctttccagctactacgactttttcagctccagaccacttggcaaagatttc
aggctcacgatgagagttcctaatcccgagattgagaagggagaagccaagcttcttgca
gaaactctcgaaatgattcctcgcagttacgactacgtcagaagcttggggatcgagcat
ccacctattttcgaggttattttgccgatgacgagaagtgctgaggaggttatgaaggtt
cacgccttttacagagattttgttgcaggtaagggtcgatttgagctgttgggtgagaaa
gtttcagactggctgggggattttttgccggaggagataaaagtcattccgctctttgaa
gacagggattcgctgatgagagcagcagaaatatcggagaggtatgcagagtgggctgag
cttgacgagctcagagtttttcttgcgaggtcggacccggcaatgaactatggatttgtt
gctgcgacaatctacgtcaaaaaggctctttacgacctttcacagctcgggatttccacg
tatcctattttgggtgttggctcgtgtcccttcaggggagggttttctccgaagaacctg
agtgtgctggatgaattcccgtccgtttacaccttcaccgtccaatctgcctttaaatac
gactacgagtttggggacgtgagaagggcgataaagagggctaaggaagcagcaaggagg
aagtcagactatgttgacgaggaacaccttcaggtggccgaaaagctgaaagatggttac
agaagaagaatcgccaagattgcggaaatcgtcaacaggatttcttccagaattccgaga
aggagaatgagaaagcttcacgttggccttttcggatattcaaggggagaggaaattaag
ttgccaagagccataaccttctgcgcgagcctttactccatcggcctgccgtctgagata
atcggaattgcggagatgagcgacaaggattacgaagcagtatgcgaggtcttcaagaac
ttcgacggaatgatggaatccgcaatgagccttttcaatcctgagagcctgaaaattgtt
gacctctcgatggactttgagagagcaaaggagcttttcggctatgagcctgatgaaaga
catctggaaaagacaaacgagataataaagcaaattgatggagatattaagaatctggtt
gtcgaggcagggattttgagaggatttctgggatag

DBGET integrated database retrieval system