KEGG   Aspergillus flavus: AFLA_004660Help
Entry
AFLA_004660       CDS       T01090                                 

Definition
(RefSeq) glycogen synthase Gsy1, putative
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
afv  Aspergillus flavus
Pathway
afv00500  Starch and sucrose metabolism
afv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AFLA_004660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:afv01003]
    AFLA_004660
Enzymes [BR:afv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     AFLA_004660
Glycosyltransferases [BR:afv01003]
 Polysaccharide
  Storage polysaccharide
   AFLA_004660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_trans_1_4 Glycos_transf_1 Glyco_transf_5 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 7910631
NCBI-ProteinID: XP_002382667
UniProt: B8NQ75
LinkDB All DBs
Position
Unknown
AA seq 722 aa AA seqDB search
MASEETGAEPPKRDVRNHMLFEVATEVANRVGGIYSVLKSKAPVTTAEYGERYTLIGPLN
RASAAVEVEELTPSNPRMIETIKSMQERGIEVIYGRWLIEGAPRVLLIDTSTGYKFLDEW
KGDLWNTAGIPSPAADTETNEAIVFGYLVAWFLGEVRLIDCTIFIAHERRVAVVAHFHEW
LAGVALPLTKKRHMDLTTIFTTHATLLGRYLCAGSVDFYNHLQHFDVDAEAGKRGIYHRY
CIERAAAHTADVFTTVSHITAFESEHLLKRKPDGVLPNGLNVKKFSAVHEFQNLHSQSKE
KINDFVRGHFYGHNDFDLDNTLYLFTAGRYEFRNKGVDMFIESLARLNHRLKASGSKTTV
VAFIIMPAQTTSLTVEALKGQAVVKSLRDTIEMIEKGIGKRMYERCLAWKEGDNMPDEKD
LMASQDRVLLRRRLFAMKRHSLPPIVTHNMNNDHEDPILNQIRRVQLFNDPTDRVKIIFH
PEFLNSSNPVLPLDYDDFVRGTHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCYM
EELIENSSDYGIYIVDRRMKGVDDSVNQLTDFMFNFALKSRRQRINQRNRTERLSDLLDW
KRMGLEYVKARQLALRRAYPSSFGSGEDFYDIIGGTEQKISRPLSVPGSPRDRSGMMTPG
DFASLQEVKEGLSTEDYIAWRLPGATDEDEPDDQYFPLTLRTKKTSDRPASPLDRISVNG
GN
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgaggagactggcgccgaacctcccaagcgggatgttcgcaaccatatgctt
ttcgaagttgcgaccgaggtggctaatagggtgggtggaatttactccgtcctcaagtct
aaagctcccgtgacgaccgccgaatatggcgagcgatacactctgattggacccttgaac
cgtgcttcagcagcggtggaggtggaagaattgactccatctaatcctcgaatgatcgag
acgatcaagtcgatgcaagaacgtggcattgaggtcatctacggtcgctggctgattgaa
ggcgctccccgggtgcttttgatcgacacatcaacgggatataaattcctggacgagtgg
aaaggggacctgtggaacacggcggggatcccatcaccggctgcagacaccgaaaccaat
gaagcgattgtctttggatacctggtagcatggttcctgggtgaagtacgtttgatagac
tgtacgatcttcatcgcccatgaaagacgggttgcggtggtcgcccatttccacgagtgg
cttgctggggtagccctcccgctgaccaagaagcgacatatggatctcaccacaattttt
accacccacgcaactttactcggtcgctatctctgtgcgggatcagtggacttttataac
cacctacagcacttcgatgtggatgcagaggctggtaagcgtggcatctatcaccggtac
tgtattgagcgagccgcggcgcacacggcagacgtcttcactaccgtctcccatatcacc
gcgttcgaaagcgagcatctcctgaaacgaaagccagatggagttctgccgaatgggctc
aatgtcaagaagttctccgcagtgcatgagttccagaatctacactcacaatccaaagag
aaaattaatgacttcgttcggggccatttctatggccataacgatttcgatctggacaat
accctgtaccttttcacggcgggacgctatgaattccggaacaagggcgtcgatatgttc
atcgaaagcttggctcgcctgaaccatcgcttaaaagccagcggctccaaaactaccgta
gttgctttcatcatcatgccagcccagaccacgtctctcacggtcgaagccctcaaggga
caggctgtcgtcaagtccttacgggacacaatcgagatgatcgaaaagggcattggaaag
cgaatgtacgagcgttgccttgcgtggaaggaaggcgacaacatgccggatgagaaggac
ctcatggccagtcaagatcgcgtgctgttgcgacgcaggttgtttgccatgaagaggcac
tctttaccgccgatcgtcactcataacatgaacaatgaccacgaagacccaattttgaac
cagatccgccgtgttcagctgttcaacgatccaaccgaccgcgttaagataatctttcac
ccagagttcctcaactcgtcgaaccccgtgctaccactcgattacgatgactttgtccgc
ggtacgcatcttggagtcttcccatcatactacgagccttggggttacacacccgctgag
tgcactgtgatgggtgtccccagtatcaccaccaatctgtccggtttcggttgctatatg
gaggagttaatcgagaactcatccgactacggtatttatatagtggatcgccgaatgaag
ggtgttgacgattccgtcaaccagcttactgatttcatgttcaactttgctctgaagagc
cgccgccaacggatcaatcaacgtaaccgcactgagcggttgagcgatctgttggactgg
aaacgtatgggattagagtatgtcaaagcgcggcagctggctcttcggcgagcctacccg
tcttcctttggtagcggcgaagacttctatgatattattggaggaacagaacagaagatt
tcacgaccgttatctgtcccagggtcaccaagggatcgctcggggatgatgacccctggt
gattttgcatccctgcaagaagtcaaagaaggactgagtactgaggactatatcgcatgg
cggctgcctggtgcaaccgatgaggatgaaccagacgaccaatacttcccactgacacta
cgaacgaaaaagacatccgatcgacccgcatcgccgctcgaccgcatatcagtcaatggt
gggaactga

DBGET integrated database retrieval system