KEGG   Aspergillus flavus: AFLA_005450
Entry
AFLA_005450       CDS       T01090                                 

Definition
(RefSeq) conserved hypothetical protein
  KO
K23647  ditryptophenaline biosynthesis N-methyltransferase [EC:2.1.1.-]
Organism
afv  Aspergillus flavus
Pathway
afv00998  Biosynthesis of various secondary metabolites - part 2
afv01100  Metabolic pathways
afv01110  Biosynthesis of secondary metabolites
Module
afv_M00891  Ditryptophenaline biosynthesis, tryptophan + phenylalanine => ditryptophenaline
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    AFLA_005450
Enzymes [BR:afv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     AFLA_005450
SSDB
Motif
Pfam: Methyltransf_33 MetW
Other DBs
NCBI-GeneID: 7919253
NCBI-ProteinID: XP_002382745
UniProt: B8NR70
LinkDB
Position
Unknown
AA seq 357 aa
MVKNNAGIVNMFEKRRTQTTTIPIIEIMREKRSEDLETEIVQGLQFDSLQLPQELLWDDA
GQILFDDLCNSSTYYLTKKEKEILQKYSTDMAATIPEGSTLIELGCGSLRKTGILLSALE
KSHKAVTYYALDVSQDSLENGLAQLHKGLGCLDHVELRGLWGTYEDAIAWLADQHPINVH
NGITFLWMGNSMTNMHLAQAQSLLSRMTKTCIGSGIPCQILVSVDSCSAEDIVMGAYDTD
SQPLKDFIMNGLKSANRILGKDVFCASDWTFGTVLDRVRHEVQVFYAPTRDVTIHIDSHP
CKITKGEKIAVISSGKWPEPYFRSMLEGIGLQVLDLWRDSDQFYCMNPLPLICSFPG
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggtgaagaacaatgccggcatcgtcaacatgttcgagaagcggcggactcaaacgact
accattccaattattgagatcatgagagagaagcggtcggaggatctggaaacggagatt
gttcaaggtcttcaatttgacagtcttcagctgcctcaggagttgttgtgggatgatgct
gggcaaatactatttgacgatttgtgcaactcctcgacctactaccttacaaaaaaagag
aaggaaatcctacagaaatattcgaccgatatggctgcaacaattcccgagggaagtacg
ctcattgagctcggttgtggaagcttgcggaaaacaggaattttattgtccgccttggaa
aaaagccacaaggcagtaacatactacgccttggacgtgtcccaggactctctggagaat
ggcctggcccagctccacaagggcctcggatgccttgatcatgtcgagctgcgagggctt
tggggcacatacgaagacgctatagcgtggcttgcagatcaacaccctattaacgtccac
aacggtatcaccttcctctggatgggaaacagcatgaccaatatgcatcttgcccaagcg
cagtcccttttgtctcgcatgacaaagacatgtattgggtcggggatcccatgccagatc
ctggtatcggtcgatagttgctcagcagaggacattgtgatgggtgcttatgacacagat
tcccaaccgcttaaggattttattatgaacggactgaagtccgcaaaccgcattttaggg
aaggacgtgttttgcgcttctgattggacatttggcacagttttggatcgtgtgcgacat
gaggtccaggtgttttacgctcctactcgcgatgttaccatccacattgattcgcatccg
tgcaaaattaccaaaggggagaagatcgcagttataagtagcgggaaatggccagaacca
tacttccggtccatgttagaaggaattggtctgcaggtgcttgacttgtggagggacagt
gaccagttttattgtatgaaccctttaccactgatctgttcctttcccggctaa

DBGET integrated database retrieval system