KEGG   Aspergillus flavus: AFLA_008890Help
Entry
AFLA_008890       CDS       T01090                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
afv  Aspergillus flavus
Pathway
afv00250  Alanine, aspartate and glutamate metabolism
afv00410  beta-Alanine metabolism
afv00430  Taurine and hypotaurine metabolism
afv00650  Butanoate metabolism
afv01100  Metabolic pathways
afv01110  Biosynthesis of secondary metabolites
Module
afv_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AFLA_008890
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AFLA_008890
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AFLA_008890
   00430 Taurine and hypotaurine metabolism
    AFLA_008890
Enzymes [BR:afv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AFLA_008890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 7918519
NCBI-ProteinID: XP_002385134
UniProt: B8NXR9
LinkDB All DBs
Position
Unknown
AA seq 514 aa AA seqDB search
MVHLAQVHRNADLDSTIKRVDSIQLENTDEDGFYSSVYGTRFATEQLPQTEMPEREMPRE
VAYRMIKDELSLDGNPMLNLASFVTTYMEDEAEKLMTESFSKNFIDYEEYPQSAEIQNRC
VNMIARLFNAPVHSEDEHPMGTSTIGSSEAIMLGTLAMKRRWQNKRKAEGKDYSRPNIVM
NSAVQVCWEKAARYFDVEERYVYCTEDRYVIDPQQAVDLVDENTIGICAILGTTYTGEYE
DVKAINDLLIERNIDVPIHVDAASGGFVAPFINPKLEWDFRLPKVVSINVSGHKYGLVYP
GVGWVVWRSPEYLPKDLIFNINYLGAEQASFTLNFSKGASQVIGQYYQMIRLGKRGYRSI
MTNITVTADFLAQELEKMGFIIMSQRRGHGLPLVAFRLPAEREGQFDEFALAHQLRERGW
IVPAYTMAPNSNNLKLMRVVVREDFTKSRCDALLSDIKLGLKTLGDMDKAMLDKYTQHVR
THATHSHKSKHNHPHYKGETHSLQGKHGKTHGVC
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggtccacctcgctcaagtccaccgcaacgctgatctcgacagcaccatcaagcgtgtc
gactccattcaattggagaacactgacgaagatggattctactctagcgtctacggaaca
cggttcgcaacagaacagctgcctcagactgagatgccggagcgggagatgcccagagag
gtcgcctatcgcatgatcaaggacgagctgagcctcgatggaaacccaatgctcaacttg
gcgagttttgtcacgacctatatggaagatgaagccgaaaagctcatgactgaatccttc
agcaagaacttcatcgattacgaggagtatcctcagtcagcggagatccagaaccgctgc
gtcaacatgattgcgcgtctgtttaacgcgccagttcacagcgaagacgagcacccgatg
ggcacctcgaccatcggatcgtccgaggcaatcatgctgggtaccctggctatgaagcgc
cgttggcaaaacaagcgcaaggctgaaggcaaggactactcccgccctaacatcgtcatg
aacagcgctgtacaggtgtgttgggaaaaggccgcacggtactttgacgtcgaggagcga
tatgtgtactgcactgaggaccgctatgtgattgatccccagcaggcggttgacctggtt
gacgagaacactatcggtatctgcgctatcctcggaaccacctacaccggtgagtatgaa
gacgtcaaagcaatcaatgaccttctgatcgaacgcaacatcgatgttcccatccatgtt
gacgccgctagcggcggtttcgtcgctcctttcatcaaccctaagttggaatgggatttc
cgcctcccaaaggtcgtttcgatcaacgtgtctggccacaagtatggtctggtctaccct
ggcgtgggctgggtcgtctggcggtccccggaatatctccccaaggatctgattttcaac
atcaactacctaggagctgaacaggccagttttaccctgaacttctctaagggtgcatct
caggtcatcggccagtactaccagatgatccgacttggcaagcgtggctaccgctccatc
atgaccaacattactgttactgcggactttttggcccaagagctggagaagatgggcttt
atcatcatgagccagcgtcgcggccacggtctcccattggtcgctttcagactgcccgct
gagcgggagggtcagttcgacgagtttgccttggcacaccagctgcgtgagcgtggctgg
attgtccctgcatacacgatggcgcccaacagcaacaacctgaagctgatgcgtgtggtt
gtccgcgaggatttcacaaagagccggtgcgacgcgctgcttagtgatatcaagttgggc
ctgaagacgttgggtgacatggacaaggccatgttggataagtacacccagcacgtccgc
acccacgccacccactcgcacaagtccaagcacaaccaccctcactacaagggagagacg
cactccctgcagggtaagcatggcaagactcatggtgtttgctag

DBGET integrated database retrieval system