KEGG   Aspergillus flavus: AFLA_022030Help
Entry
AFLA_022030       CDS       T01090                                 

Definition
(RefSeq) glutathione-S-transferase theta, GST, putative
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
afv  Aspergillus flavus
Pathway
afv00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AFLA_022030
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:afv02000]
    AFLA_022030
Enzymes [BR:afv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AFLA_022030
Transporters [BR:afv02000]
 Other Transporters
  Pores ion channels [TC:1]
   AFLA_022030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_5 GST_C_3
Motif
Other DBs
NCBI-GeneID: 7916938
NCBI-ProteinID: XP_002376223
UniProt: B8N575
LinkDB All DBs
Position
Unknown
AA seq 285 aa AA seqDB search
MAPIPDAAVHPEATGAAKVLVENHRAEQPLKLYAGWFCPFVQRVWLALEEKQIPYQYIEV
NPYHKPQSLLSLNPRGLVPTLSCLVKDGGVRAAKPLYESTVILEYLEEAYPDSSPRLLPV
DPYDRARVRIWIDYVTSRIIPAFHRFLQYQPKAGGEDPTAGLERLRQEFLGHLKEWTREM
HVDGPFFLGDQITLPDLVLAPWAVRLWVFDEYKSGGLGIPAGGNGGEDELVWQRWRKWLK
AVEDRRSVRETTSEKGYYLPVYKRYADNVAQSELAKATREGRGVP
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcccccattccagatgcagcagtccaccctgaagcaacgggggctgctaaagtgtta
gtcgaaaatcatcgtgcggagcaaccattaaagctgtatgcggggtggttttgtcccttt
gtccaacgggtttggctcgcactagaagagaaacaaatcccttaccagtacatcgaagtc
aacccctatcacaagccccagtcacttctttcactgaatccgcgcggtctggtgccgaca
ctatcttgcctggtaaaagacgggggtgtccgggcagccaaacccctttatgaatccacg
gttattcttgagtacctcgaggaggcctatccagatagctctccacggctcctcccagta
gacccctacgacagagcccgagtacgcatctggatcgactatgttacctcgcggatcatc
ccggctttccatcgattccttcaataccagcccaaggcaggaggtgaagacccaacggct
ggcttggagagactcagacaggagtttctgggccatctcaaggagtggactagggaaatg
catgtcgacggaccattcttcttgggagatcagattacactgccagatctggtcctcgcc
ccatgggcggtccggttgtgggtctttgatgaatataaatccggtggacttggcatccca
gcgggaggcaatggaggggaggatgagcttgtttggcagcggtggagaaagtggctaaaa
gccgtagaggataggagaagtgtgagagaaactacgagtgagaaggggtactacctccca
gtctataagcggtatgcagacaatgtggcgcagagtgagttggcaaaggctacccgtgaa
gggaggggggtgccatga

DBGET integrated database retrieval system