KEGG   Aspergillus flavus: AFLA_027780Help
Entry
AFLA_027780       CDS       T01090                                 

Definition
(RefSeq) glutathione-S-transferase omega, putative
Organism
afv  Aspergillus flavus
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 7910281
NCBI-ProteinID: XP_002374288
UniProt: B8N103
LinkDB All DBs
Position
Unknown
AA seq 295 aa AA seqDB search
MVSFSMFLRSLFQTQRQRLLSYLEFPAICLPPAVYSRSLIQPAQKVRAMSTQNQPSQKTY
HTKATGLAALTVSNHSSENELKLYGSCFCPFVQRVWIALEAKGIPYQYIEVDPYKKPQSL
LEVNPRGLVPALRHGDWGSHESTVLLEYLEDLNTGPPLLPPGDAKLRAYCRLWADFINRN
IVPTFYRVLQEQDEQKQISNAQELKDAFATLVNAADSQGPFFLGANISFVDVQVAPWIIR
LSRVLKPYRAWPDPDAGSRWGAWVNAIEANEHVKATTSDDELYIDSYERYARRFP
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggtttcattttcaatgttcctcagatcccttttccaaacacaaagacagcggctgtta
tcctacctggaatttcccgccatttgtttaccaccagctgtctattctcggagtctaatt
caacccgcccaaaaggtcagggcaatgtctacccaaaaccaaccttcgcagaagacctat
cacacaaaagccaccggcttggctgccctgacggtgtctaaccattccagcgagaatgaa
ttgaaactgtacggcagctgtttctgtcccttcgtgcagcgtgtatggatagccttggag
gccaagggcattccgtatcagtatatcgaggtagacccctacaaaaagcctcagtcccta
ttggaggtgaacccaaggggccttgtccctgccctgcggcacggagattgggggtcacat
gaaagtactgttttgctagaatatcttgaagacttgaacaccgggccgcctctgctcccg
ccaggggatgcgaaattgcgagcctattgccgactctgggcagactttatcaaccgcaac
atagtgcccaccttctaccgtgtccttcaggaacaggatgagcagaagcagatttcaaat
gcgcaagaacttaaggatgcattcgctacgctagtgaatgccgccgactcacaaggccca
ttcttcctgggagctaatatatcatttgtggatgtccaggtggctccctggatcatccga
ttgagccgcgtcctgaagccctaccgcgcttggccggaccccgacgcagggagccgatgg
ggcgcctgggttaacgcgatcgaagctaatgagcacgtcaaagcgacgacaagtgacgat
gaactctatattgacagttatgaacgatatgcccgtaggttcccttaa

DBGET integrated database retrieval system