KEGG   Aspergillus flavus: AFLA_031490Help
Entry
AFLA_031490       CDS       T01090                                 

Definition
(RefSeq) DNA ligase I, putative
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
afv  Aspergillus flavus
Pathway
afv03030  DNA replication
afv03410  Base excision repair
afv03420  Nucleotide excision repair
afv03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:afv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AFLA_031490
   03410 Base excision repair
    AFLA_031490
   03420 Nucleotide excision repair
    AFLA_031490
   03430 Mismatch repair
    AFLA_031490
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:afv03032]
    AFLA_031490
   03400 DNA repair and recombination proteins [BR:afv03400]
    AFLA_031490
Enzymes [BR:afv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AFLA_031490
    6.5.1.6  DNA ligase (ATP or NAD+)
     AFLA_031490
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     AFLA_031490
DNA replication proteins [BR:afv03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    AFLA_031490
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     AFLA_031490
DNA repair and recombination proteins [BR:afv03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     AFLA_031490
   NER (nucleotide excision repair)
    Other NER factors
     AFLA_031490
   MMR (mismatch excision repair)
    Other MMR factors
     AFLA_031490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 7913951
NCBI-ProteinID: XP_002374659
UniProt: B8N3R5
LinkDB All DBs
Position
Unknown
AA seq 827 aa AA seqDB search
MSSPAKKRKRDVPVSSPYRNRSIASFFQGQAAKQADNAEQTPSTVSEDTDQTLSDEALAR
KLQEEWNRQDAAPASDTQAPTGEPFATPSNTKDDELEPPNKTQKRNTLSLQSSTGTEDTI
SLAVPFDQSPLTFDSTKCAEELKGHWAATGGDASYALLTRAFVLANATTSRIKIVDTLVN
FLRVLIEADPSSVLPAVWLATNSISPPYDELELGLGGSSISKALKKIYGLNSQGLKSLYD
KLGDAGDVAFEAKKRQSFTLMKPKPLTVKGVYQSLQKIAMSKGTGSQETKQRIVEKLLQD
TRGAEESRYIVRTLVQNLRIGAVKTTMLIALARAFLYSKPEGADFAVRSQQELACLKKED
LAEIYNNAEEIVKASYARHPDYNDLVPCLLEIGVTEELLVRCGLQLHIPLRPMLGSITRD
LSEMLTKLQGRDFTCEYKYDGQRAQVHCDENGKVSIFSRHLENMTEKYPDLVSLVPQIRG
ESVSSFILEGEVVAVDQETGELQAFQILTNRAKKNVDIGTIKINVCLFSFDLMYLNGTPL
LDRPFRERRELLRSLFVEIPNRFTWVKSFDATSADSEAVLEFFKGATDTKCEGIMVKVLD
NVSKSNNPEPSETPNNDIDKPDPKPAKGGRRKALLSTYEPDKRLESWLKVKKDYSTSSET
LDLIPVGGWHGQGRKAKWWSPILLAVRNPETGSLEAVTKCMSGFTDKFYQANKDKYTEGS
PNVISRPSYVEYYGEPDVWFEPQEVWEMAFADITLSPTYTAAIGLVSDERGLSLRFPRFL
RVREDKSIDEATTSDYLALLWRKQFERSQKEEAKPPAPDAELGWQEE
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atgtctagcccggccaaaaagcgcaagagagatgtccccgtctcatccccctaccgcaat
cgaagcatagcgtcattcttccagggccaagcagccaagcaagctgataatgcggagcag
actccgtcaactgtgtctgaagatacagaccaaactctttccgatgaagctctcgcccgc
aagctccaagaagaatggaaccggcaagatgctgccccggcttcagatactcaggcacca
actggtgaacccttcgcaacgccgtcgaacaccaaagacgacgaactagagccgccaaac
aagacacagaagaggaatacactatcgttgcagtcttctaccggcacagaagacaccatt
tctcttgcagtgccttttgatcaaagtcccttgacattcgactcaacgaaatgtgcagag
gagttaaaagggcactgggctgccacaggtggcgatgcttcatatgctctcttaaccaga
gcctttgtacttgcaaatgccacaacaagccgcatcaaaattgtggatacactcgttaac
ttcctgcgagtgctcattgaagccgacccttcgagtgtcctccctgcagtatggctagca
accaactcgatctctccaccatacgatgagttggagctaggactcggtggatcttctatt
tcgaaggcattgaagaagatatatggactcaatagccaagggctcaaatcgctgtatgac
aaacttggagacgccggtgatgtggcgttcgaagctaaaaagagacagagcttcacgtta
atgaagcccaaaccattgacggtcaaaggggtatatcagtccctgcaaaagattgcgatg
agcaagggcacaggaagccaggaaactaaacagagaatcgtcgagaaactgttgcaggat
actaggggcgcggaagaaagccggtatattgtgaggacgctcgtccaaaacttgcgaata
ggagctgtaaagactaccatgctcatcgcactcgcccgcgctttcctgtactctaaaccg
gaaggcgccgacttcgctgtccgttcccaacaagagttggcttgtctgaaaaaggaagac
ctggctgaaatttacaacaatgcagaggagattgtcaaggcttcatatgctagacatcct
gattacaatgatctagttccctgtttgctcgagataggggtcacggaagaactccttgta
cgatgtggcctacaactacatataccgttgaggccaatgttaggcagcatcactcgggac
ctctccgagatgttgacgaaacttcaaggacgggattttacctgcgaatacaaatatgac
gggcagcgtgcccaagtgcactgtgacgagaatggcaaagtatcgatattctctcgtcat
ctggaaaatatgacagagaaatacccggacctggtgtccctggttccgcagattagaggc
gagagcgtgtcgagcttcatactagagggtgaagtagtcgccgtggaccaggaaacgggg
gaactccaagcctttcaaattttgaccaaccgagccaaaaagaacgttgatataggaact
atcaagattaatgtttgtctcttttcatttgacctgatgtacctgaacggaacccctttg
ttggatcgacctttccgcgaacgtagagaacttctacgaagcttattcgtggaaatcccg
aaccggttcacatgggtaaagagttttgatgccacatctgccgattctgaggccgtcctg
gaatttttcaaaggtgcaactgataccaagtgcgaaggcatcatggtcaaggtgctcgac
aatgtgtcgaagtcaaataacccggaaccatcagagaccccaaacaacgacatagacaaa
ccggatccaaaacccgcgaaaggaggccgccgaaaggccttactttccacatacgaacca
gacaaaaggcttgaatcctggctcaaagtcaaaaaggattacagcacctcatccgagacc
ctcgacctgatccccgtcggaggctggcacggacaaggccggaaagccaaatggtggtca
cccatcctgttagctgtacggaatcccgaaaccggcagcctcgaagccgttacaaagtgt
atgtccggcttcacggacaagttctaccaggccaacaaggataaatacaccgaaggcagc
cccaacgtgatctcacggcccagctacgtcgaatactacggcgagccggacgtctggttc
gagccgcaggaggtgtgggagatggcctttgcagatatcacactcagcccgacttacacg
gctgccatcgggctggtgagcgatgaacgaggtcttagtcttcggtttcctcggtttctt
cgcgtccgcgaggacaagtccattgatgaggctaccacgtcggattacctagccttactg
tggaggaagcagttcgaacgttcccagaaagaagaagcgaaaccccctgctccagatgct
gagctaggttggcaggaggagtga

DBGET integrated database retrieval system