KEGG   Aspergillus flavus: AFLA_036990Help
Entry
AFLA_036990       CDS       T01090                                 

Definition
(RefSeq) DNA polymerase V, putative
  KO
K02331  DNA polymerase phi [EC:2.7.7.7]
Organism
afv  Aspergillus flavus
Brite
KEGG Orthology (KO) [BR:afv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:afv03036]
    AFLA_036990
   03400 DNA repair and recombination proteins [BR:afv03400]
    AFLA_036990
Enzymes [BR:afv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AFLA_036990
Chromosome and associated proteins [BR:afv03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    AFLA_036990
DNA repair and recombination proteins [BR:afv03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   DNA polymerases
    AFLA_036990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_phi Nop14
Motif
Other DBs
NCBI-GeneID: 7913846
NCBI-ProteinID: XP_002375208
UniProt: B8N4J5
LinkDB All DBs
Position
Unknown
AA seq 987 aa AA seqDB search
MAQNQAGSKKRRREPVNVDTKLVEIYEDLASEKDEIRLKAAQALVSQFTPDKNATDDQIQ
KTLRRLFRGLCSSRKAARIGFSIALTEILSQILSSPRESSEFDIPRVVGFWESQSSASGS
ESGQEQRDHHFGRLFGAEAIIKSGILFKPNAPFSEWTKLLDLVFDLAKKKPWIREECGWI
VYRCVYELSAQKAEAKFVESALERLCTNELARTPEGVAIWLAAKDLFPKVKLPSKVWKHD
DPLDVKERNQLAKVMKESSVSEAEGENKGSNPKSSGVWNSKLHFAWDAVLSRLSETSAKE
SKSKTSRLSFSDFWTEVVDNGLFAASSSDERKYWGFLLFVKVLNESPLPLASLVFTKNLV
RCLTNQLAVEDRYLHRMAAKAAKTIQTRVSKEPEFAAASINGLMGSAGSVNFDQVTKTKT
VEKIVIEANLDALKQIVPLFEKLVACPGTSDSKAAASSRQFLAGLLLSIVRSRASASDES
EEGAKEVLEQILFTFVRFAYFVEKEGDSRGQTAAEPALTEQTQELFRSRINSCLNSLIAN
QKYATALPYAVVRKVRDAAKSEEYGKFIIAMDDTLQDSVKGAFKSLKKLSNTEKKGDAAG
VDAFKLLYSMTILQVYNGDADAVSMLDELDFCFSKIFGDKKSKKDETADASDALVEILLS
FASKPSQLFRRMSEQVFGAFADKISENGLDSLVSILEAKESLAGQQEMFEQDDEGEEDEE
MMDVDEDDSDVEVIDAEGSNDDEDEDDEEEGSEEEEDGNDDEEAIFEAKLAEALGPHRAN
QDLNDDDEGSDADMNDDEMEQVDQQLAKVFQARRDALSKNKDKKDAKGNMVNFKNRVLDL
LEIYVKKCHSKLLALDLLLPLLRLTRKSTVKQISNKANSVLRDYTRLCKGSALPKLESVE
PAWELLNSIHKEASHSGPPSHASACSQASLLMVKVLVAHDKNNISGIVDVYAETRKQQFL
SKKCHVQPSFFSEWSNWCVSASKQMKN
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaaaccaggccggttctaagaagagacgccgcgagccagtcaacgttgatacc
aagctggtggaaatttacgaagatctcgcgagcgagaaagatgagatcagactgaaagct
gcgcaagcgctggtgtcgcaatttacgcccgacaagaatgctacagatgaccagatccaa
aagactctgcggagacttttccgcggcctctgcagtagcagaaaagctgcgcgcattggt
ttttctatcgccttgactgagattctgtctcaaattctttccagccccagagagtcttca
gaatttgatatcccgagggtagtagggttctgggagtcacagtctagcgcttccggaagc
gagtcgggtcaggaacaaagagatcatcactttggacgtttatttggtgcagaggctatt
atcaagtctggtattcttttcaagcccaacgcgcctttctctgagtggactaagctccta
gacctggtctttgatctggccaagaagaagccctggatcagggaagaatgcggttggatc
gtctaccgctgtgtctatgaattatctgctcagaaggccgaagcaaagtttgtggaatcc
gctcttgagcgcctttgcacaaatgagctggcacggacgccagagggagttgctatttgg
ctagcagccaaggacttattccctaaagtgaaacttcctagtaaagtttggaaacatgac
gacccactagacgtcaaggagaggaatcagctggcaaaggtcatgaaggaatcttcagtg
tccgaggctgaaggtgaaaataagggtagcaaccccaagtcatcgggcgtgtggaattca
aagcttcactttgcttgggatgctgtgttgtctaggctcagcgaaacctcagcaaaggag
agcaaatcgaagacctctcggcttagcttcagtgatttctggacagaggttgtcgacaat
ggtctctttgccgcttcctcctcggacgagcgtaaatactggggtttcctcctcttcgtc
aaggtgttgaatgagagccccttgccattggcttcccttgtgttcacaaagaaccttgtg
agatgccttacaaatcagctcgctgttgaggaccggtaccttcaccgtatggcggctaag
gctgcaaagactatccagacccgcgtgtcaaaggaacccgagtttgccgcagcttcgatc
aatggtttgatgggctcggcgggctcagtgaactttgatcaagtcaccaagaccaagaca
gtggagaagatcgtgatcgaggccaacttagatgccctcaagcagattgtgcccctcttc
gaaaagctcgtcgcatgcccgggtacaagtgacagcaaagctgctgcctcaagccgccag
ttccttgctggtttgcttctgtccattgttaggtctcgggcttccgctagcgatgaatcg
gaagagggtgctaaggaggtgctcgaacaaattctgttcactttcgtgcgatttgcctac
tttgtggagaaagagggtgacagccgcggtcagaccgctgctgagccagccctcactgag
cagactcaggagctcttccggagcaggatcaactcctgcctgaacagcctaatcgccaac
cagaagtacgcaactgctcttccttatgcagttgtccgcaaggttcgggatgcagctaag
tcggaggagtatggcaagtttatcatcgctatggatgataccctgcaggattcagtgaag
ggcgcatttaaatcgctgaagaaattgtcaaacacggaaaagaagggtgatgccgctggc
gtcgatgcattcaagcttctttactctatgaccatccttcaggtgtacaacggcgatgct
gatgctgtttccatgctggacgaacttgacttctgcttctcaaagattttcggagacaag
aagtctaagaaggacgagacagcagatgcttccgatgcgctggtggaaattcttttgagt
ttcgcttcgaagccttcccagctcttccgccgtatgagtgaacaagtttttggtgccttc
gccgataagatttctgagaatggactggattctctggtctccatcttggaagcgaaagag
agtcttgcgggtcagcaagagatgttcgaacaggacgatgaaggagaagaagacgaggag
atgatggatgttgatgaagacgacagtgacgtcgaagtcatcgacgcagagggctcaaat
gatgacgaagacgaagacgacgaggaggagggatctgaagaggaagaagatggaaacgat
gacgaagaagctatcttcgaggccaagcttgccgaagcactcggaccgcaccgtgcaaac
caagacctgaacgatgacgatgaaggctcagacgccgacatgaacgacgacgagatggaa
caggtagaccagcagctcgctaaggtgttccaggcgcgccgggatgccctgagcaaaaac
aaagacaagaaagacgcaaagggcaacatggttaacttcaagaaccgtgttcttgacctt
cttgagatttatgtcaagaagtgccactcgaaactcctggctctcgatctccttctccct
cttctacgtcttactcgcaagtctaccgtcaaacagatctcgaacaaggccaactccgtg
ctgcgcgattacacgagactgtgcaagggctctgctctgcccaagttagagtccgttgag
cctgcctgggagctcctgaactcgatccacaaggaggccagccacagcggcccgccctcg
cacgcttcggcttgcagccaggcaagtcttcttatggttaaggttctcgtcgcacacgac
aagaacaacatctcgggcattgtggatgtctacgccgagacccgaaagcagcagttcctc
agcaagaaatgccatgtccagccttcgttcttcagcgaatggagcaactggtgtgtttcc
gccagcaagcagatgaagaactga

DBGET integrated database retrieval system